Result : Q1D773
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP000113.1 |
| Organism | Myxococcus xanthus (strain DK 1622) |
| Left | 3855608 |
| Right | 3855901 |
| Strand | + |
| Nucleotide Sequence | ATGAATCTGAACGACGTCATCAAGGGCCCGCTCATCACCGAGAAGCTGGACAAGGCCCGCGAGAAGTTCCGTCAGTACTCGTTCATCGTCGACCGCAAGGCGACGAAGCACGACGTCGCCCGTGCGGTGGAGACGCTCTTCAAGGTCACCGTCGAGGGCGTGAACACCAACATCGTCCGCGGCAAGATCAAGCGGGTGGGTCGTAGCATCGGCAAGCGGCCCAACTTCAAGAAGGCGGTTGTGACGCTGAAGCAGGGCGACTCGATCGAACTCTTCGAGGGAGGGGCGGCCTGA |
| Sequence | MNLNDVIKGPLITEKLDKAREKFRQYSFIVDRKATKHDVARAVETLFKVTVEGVNTNIVRGKIKRVGRSIGKRPNFKKAVVTLKQGDSIELFEGGAA |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 17015832 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1D773 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 71
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4600438 | 4600731 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 2 | 3895696 | 3895989 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 3 | 3855608 | 3855901 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 4 | 5967392 | 5967685 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 5 | 3749114 | 3749407 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 6 | 7986633 | 7986926 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 7 | 2273537 | 2273830 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 8 | 2345291 | 2345581 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 9 | 2071902 | 2072138 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 10 | 4014790 | 4015074 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 11 | 5223954 | 5224238 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 12 | 1515070 | 1515354 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 13 | 3127624 | 3127908 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 14 | 181785 | 182069 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 15 | 745005 | 745289 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 16 | 701595 | 701879 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 17 | 2415025 | 2415312 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 18 | 1247729 | 1248013 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 19 | 1171421 | 1171657 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 20 | 2377577 | 2377864 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 21 | 314506 | 314790 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 22 | 1049528 | 1049791 | + | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 23 | 1076058 | 1076342 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 24 | 1274660 | 1274944 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 25 | 368009 | 368266 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 26 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 27 | 233484 | 233738 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 28 | 3350324 | 3350614 | - | NZ_CP040924.1 | Clostridium thermarum |
| 29 | 5186502 | 5186804 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 30 | 215307 | 215546 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 31 | 305569 | 305823 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 32 | 3234802 | 3235092 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 33 | 215159 | 215401 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 34 | 2973315 | 2973554 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 35 | 1252900 | 1253178 | + | NZ_CP064781.1 | Azospira restricta |
| 36 | 3111022 | 3111276 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 37 | 1405148 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 38 | 1674039 | 1674323 | - | NZ_LT906470.1 | Veillonella rodentium |
| 39 | 1616290 | 1616574 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 40 | 1672886 | 1673170 | - | NZ_LR134375.1 | Veillonella dispar |
| 41 | 1732556 | 1732840 | - | NZ_LR778174.1 | Veillonella parvula |
| 42 | 2104552 | 2104791 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 43 | 345077 | 345313 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 44 | 1564654 | 1564911 | - | NZ_CP038452.1 | Thermus caldilimi |
| 45 | 2244015 | 2244302 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 46 | 1754516 | 1754785 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 47 | 129335 | 129574 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 48 | 234415 | 234654 | + | NZ_CP028897.1 | Dongshaea marina |
| 49 | 782622 | 782921 | + | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
| 50 | 321049 | 321306 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 51 | 238834 | 239121 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 52 | 64562 | 64855 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 53 | 1332582 | 1332872 | + | NZ_CP016312.1 | Thermus brockianus |
| 54 | 1589237 | 1589494 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 55 | 410767 | 411024 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 56 | 259577 | 259834 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 57 | 1563310 | 1563570 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 58 | 377551 | 377832 | + | NC_014207.1 | Methylotenera versatilis 301 |
| 59 | 1143204 | 1143488 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 60 | 2748876 | 2749118 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 61 | 833428 | 833688 | + | NZ_LR134365.1 | Cardiobacterium hominis |
| 62 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 63 | 2411393 | 2411674 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 64 | 439341 | 439595 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 65 | 142995 | 143282 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 66 | 470981 | 471235 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 67 | 1349937 | 1350212 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 68 | 303859 | 304113 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 69 | 3930269 | 3930523 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 70 | 2422864 | 2423154 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 71 | 400360 | 400602 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012109.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00252.20 | 0.99 | 70 | 2231.0 | same-strand | Ribosomal protein L16p/L10e |
| 2 | PF00189.22 | 1.0 | 71 | 1544 | same-strand | Ribosomal protein S3, C-terminal domain |
| 3 | PF07650.19 | 1.0 | 71 | 1544 | same-strand | KH domain |
| 4 | PF00237.21 | 0.96 | 68 | 1183.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00203.23 | 1.0 | 71 | 889 | same-strand | Ribosomal protein S19 |
| 6 | PF03947.20 | 1.0 | 71 | 27 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 7 | PF00181.25 | 1.0 | 71 | 27 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 8 | PF00573.24 | 0.99 | 70 | 8.0 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF00338.24 | 0.93 | 66 | 1341.5 | same-strand | Ribosomal protein S10p/S20e |
| 10 | PF00009.29 | 0.89 | 63 | 2096.5 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF03143.19 | 0.87 | 62 | 1744.5 | same-strand | Elongation factor Tu C-terminal domain |
| 12 | PF03144.27 | 0.9 | 64 | 2096.5 | same-strand | Elongation factor Tu domain 2 |
| 13 | PF01926.25 | 0.82 | 58 | 1757.5 | same-strand | 50S ribosome-binding GTPase |
| 14 | PF03764.20 | 0.79 | 56 | 2974.5 | same-strand | Elongation factor G, domain IV |
| 15 | PF14492.8 | 0.79 | 56 | 2974.5 | same-strand | Elongation Factor G, domain III |
| 16 | PF00679.26 | 0.79 | 56 | 2974.5 | same-strand | Elongation factor G C-terminus |
++ More..