Result : Q1D757
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | CP000113.1 |
| Organism | Myxococcus xanthus (strain DK 1622) |
| Left | 3863403 |
| Right | 3863672 |
| Strand | + |
| Nucleotide Sequence | ATGGCGCTCAAGGTGAAGCTGGTGAAGAGCTTTGCGGGTGCGTCCAGCGACATGCTGGACACCATCCGTGGGCTGGGCCTGAAGAAGTTCGGTGACGAGCGGCTCCTCAAGGACACGCCTGCGGTTCGCGGGATGGCGTTCAAGGTGAAGCACCTGGTCACCCTGGAAACCGTTTCCGGCGACGCGCCGGCGCCCAAGCGCCGCAAGCCCGCCAAGATTGCCCTGCGGGAGCGGGCGATCGCGTATCAGGCCAAGCAGAACAAGGCCTGA |
| Sequence | MALKVKLVKSFAGASSDMLDTIRGLGLKKFGDERLLKDTPAVRGMAFKVKHLVTLETVSGDAPAPKRRKPAKIALRERAIAYQAKQNKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 17015832 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1D757 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3863403 | 3863672 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 2 | 3903509 | 3903778 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 3 | 4592643 | 4592912 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 4 | 5959605 | 5959874 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 5 | 3756906 | 3757175 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008095.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 1.0 | 5 | 2235 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00410.21 | 1.0 | 5 | 1643 | same-strand | Ribosomal protein S8 |
| 3 | PF00347.25 | 1.0 | 5 | 1012 | same-strand | Ribosomal protein L6 |
| 4 | PF00861.24 | 1.0 | 5 | 547 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF00333.22 | 1.0 | 5 | 4 | same-strand | Ribosomal protein S5, N-terminal domain |
| 6 | PF03719.17 | 1.0 | 5 | 4 | same-strand | Ribosomal protein S5, C-terminal domain |
| 7 | PF00828.21 | 1.0 | 5 | 21 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00344.22 | 0.8 | 4 | 682.5 | same-strand | SecY |
| 9 | PF00406.24 | 1.0 | 5 | 2192 | same-strand | Adenylate kinase |
| 10 | PF13207.8 | 1.0 | 5 | 2192 | same-strand | AAA domain |
| 11 | PF05191.16 | 1.0 | 5 | 2192 | same-strand | Adenylate kinase, active site lid |
| 12 | PF13238.8 | 1.0 | 5 | 2192 | same-strand | AAA domain |
| 13 | PF01176.21 | 1.0 | 5 | 3237 | same-strand | Translation initiation factor 1A / IF-1 |
++ More..