Result : Q1D6E2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP000113.1 |
| Organism | Myxococcus xanthus (strain DK 1622) |
| Left | 4188268 |
| Right | 4188474 |
| Strand | + |
| Nucleotide Sequence | ATGCCGAAGTTGAAGACCCGCAGCAGCGCGAAGAAGCGCTTTGACGTGAAGAAGAGCGGCAAGGTCAAGCACGGCAAGGCCTTCGCGAAGCACCTCTTCACGTTCTCGAAGACGCCGAAGTCCAAGCGCAGCAACCGCGGGACCGGCCACCTTCGCGACATGGACGCGAAGAAGGTCATCAAGGAGATGTTCCCCTACGGGGGCTGA |
| Sequence | MPKLKTRSSAKKRFDVKKSGKVKHGKAFAKHLFTFSKTPKSKRSNRGTGHLRDMDAKKVIKEMFPYGG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17015832 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1D6E2 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 81
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4188268 | 4188474 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 2 | 4226470 | 4226676 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 3 | 4229742 | 4229948 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 4 | 5626657 | 5626863 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 5 | 5646669 | 5646875 | - | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 6 | 8445329 | 8445538 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 7 | 1122683 | 1122886 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 8 | 2246057 | 2246260 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 9 | 1799850 | 1800050 | + | NZ_CP054142.1 | Treponema parvum |
| 10 | 762738 | 762938 | - | NZ_CP030032.1 | Bradymonas sediminis |
| 11 | 517313 | 517510 | + | NZ_CP031555.1 | Thalassospira indica |
| 12 | 1247113 | 1247310 | + | NZ_CP016210.1 | Azoarcus olearius |
| 13 | 724127 | 724330 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 14 | 4040004 | 4040201 | - | NZ_CP024199.1 | Thalassospira marina |
| 15 | 2355217 | 2355420 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 16 | 1763659 | 1763862 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 17 | 1071952 | 1072149 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 18 | 1900510 | 1900713 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 19 | 1777935 | 1778132 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 20 | 1097758 | 1097955 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 21 | 4084927 | 4085124 | - | NZ_CP028324.1 | Massilia armeniaca |
| 22 | 373375 | 373572 | + | NZ_CP021520.1 | Neisseria meningitidis |
| 23 | 2521945 | 2522142 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 24 | 1681919 | 1682116 | + | NZ_CP031325.1 | Neisseria polysaccharea |
| 25 | 1620390 | 1620587 | + | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 26 | 204663 | 204860 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 27 | 282376 | 282573 | + | NZ_CP072524.1 | Neisseria sicca |
| 28 | 1432430 | 1432633 | - | NZ_CP020083.1 | Blastomonas fulva |
| 29 | 2468418 | 2468615 | - | NZ_CP059571.1 | Neisseria bacilliformis |
| 30 | 2127377 | 2127574 | - | NZ_LR134313.1 | Neisseria canis |
| 31 | 1274657 | 1274854 | - | NZ_CP031252.1 | Neisseria elongata |
| 32 | 644290 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 33 | 624283 | 624486 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 34 | 272014 | 272217 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 35 | 2512540 | 2512743 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 36 | 4794474 | 4794671 | + | NZ_CP024608.1 | Massilia violaceinigra |
| 37 | 2228537 | 2228734 | - | NZ_CP040017.1 | Massilia umbonata |
| 38 | 2320624 | 2320821 | + | NZ_CP036401.1 | Massilia albidiflava |
| 39 | 2177032 | 2177235 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 40 | 1429631 | 1429831 | - | NZ_CP019038.1 | Massilia putida |
| 41 | 1202058 | 1202255 | - | NZ_CP046904.1 | Massilia flava |
| 42 | 1195316 | 1195513 | - | NZ_CP059567.1 | Neisseria shayeganii |
| 43 | 3132402 | 3132599 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 44 | 4406419 | 4406616 | - | NZ_CP048832.1 | Janthinobacterium lividum |
| 45 | 453797 | 453994 | - | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 46 | 2659052 | 2659255 | + | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 47 | 4324033 | 4324230 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 48 | 2014236 | 2014433 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 49 | 1651238 | 1651441 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 50 | 1429763 | 1429960 | + | NZ_CP059564.1 | Alysiella filiformis |
| 51 | 97888 | 98091 | + | NZ_AP019773.1 | Bartonella quintana |
| 52 | 427790 | 427987 | + | NZ_CP039887.1 | Neisseria subflava |
| 53 | 3345790 | 3345987 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 54 | 2643275 | 2643478 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 55 | 3609086 | 3609289 | + | NZ_CP034909.1 | Ensifer alkalisoli |
| 56 | 3594434 | 3594637 | + | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 57 | 3083998 | 3084201 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 58 | 1839630 | 1839827 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 59 | 1036221 | 1036418 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 60 | 4913715 | 4913918 | - | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 61 | 753095 | 753298 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 62 | 2669633 | 2669836 | + | NC_015138.1 | Acidovorax avenae subsp. avenae ATCC 19860 |
| 63 | 906062 | 906265 | + | NZ_CP053015.1 | Sphingomonas lacunae |
| 64 | 325096 | 325293 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 65 | 1779965 | 1780168 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 66 | 2379948 | 2380151 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 67 | 545602 | 545805 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 68 | 1668896 | 1669093 | + | NZ_CP022278.1 | Neisseria chenwenguii |
| 69 | 1517243 | 1517440 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 70 | 1535537 | 1535734 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 71 | 3127565 | 3127765 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 72 | 1525880 | 1526077 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 73 | 15528 | 15725 | + | NZ_CP031699.1 | Neisseria animalis |
| 74 | 1321677 | 1321874 | - | NZ_CP059569.1 | Kingella oralis |
| 75 | 314112 | 314309 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 76 | 706514 | 706711 | + | NZ_CP034120.1 | Glaciecola amylolytica |
| 77 | 3510060 | 3510257 | - | NZ_CP032157.1 | Paraflavitalea soli |
| 78 | 1922699 | 1922896 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 79 | 355248 | 355445 | + | NZ_LS483369.1 | Neisseria cinerea |
| 80 | 367329 | 367526 | + | NZ_CP039886.1 | Neisseria flavescens |
| 81 | 435910 | 436107 | + | NZ_CP031253.1 | Neisseria lactamica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017030.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 1.0 | 81 | 20 | same-strand | Ribosomal protein L20 |
| 2 | PF01409.22 | 0.83 | 67 | 605 | same-strand | tRNA synthetases class II core domain (F) |
| 3 | PF02912.20 | 0.83 | 67 | 599 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 4 | PF03483.19 | 0.75 | 61 | 1719 | same-strand | B3/4 domain |
| 5 | PF17759.3 | 0.74 | 60 | 1716.5 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 6 | PF03147.16 | 0.74 | 60 | 1716.5 | same-strand | Ferredoxin-fold anticodon binding domain |
| 7 | PF01588.22 | 0.75 | 61 | 1719 | same-strand | Putative tRNA binding domain |
| 8 | PF03484.17 | 0.75 | 61 | 1719 | same-strand | tRNA synthetase B5 domain |
| 9 | PF00707.24 | 0.69 | 56 | 148.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
++ More..