Result : Q1D295
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative septation protein SpoVG |
| NCBI Accession ID | CP000113.1 |
| Organism | Myxococcus xanthus (strain DK 1622) |
| Left | 6349147 |
| Right | 6349446 |
| Strand | + |
| Nucleotide Sequence | ATGAACATCACCGACGTCCGGGTGTTTCCGGTCGAAGAGGACAAGCTCAAGGCGTACGTCACCATCACCTTGGACCACTGCTTCGTCATTCGCGATTTGAAGGTCATTCACGGCTCGACCGGGCTCTTCATCGCGATGCCAGCCAAGAAGCGGAAGGATGGGACGTACAAGGACATTGCCCACCCGCTCAACGCGGATACGCGGAGTCAAATGGAACGCGTCATCCTGATGGAGTACGAGCGACACCTCCATCAGGCGCAAGCCGGGATGCTCGTCGCAGCGCCAGCGGACCTCGACTAA |
| Sequence | MNITDVRVFPVEEDKLKAYVTITLDHCFVIRDLKVIHGSTGLFIAMPAKKRKDGTYKDIAHPLNADTRSQMERVILMEYERHLHQAQAGMLVAAPADLD |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in septation. {ECO:0000255|HAMAP-Rule:MF_00819}. |
| Pubmed ID | 17015832 |
| Domain | CDD:412646 |
| Functional Category | Others |
| Uniprot ID | Q1D295 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 101
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6265250 | 6265549 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 2 | 6349147 | 6349446 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 3 | 2131634 | 2131933 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 4 | 7191292 | 7191591 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 5 | 2920912 | 2921211 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 6 | 6860684 | 6860986 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 7 | 157893 | 158198 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 8 | 2713643 | 2713951 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 9 | 826236 | 826520 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 10 | 2209600 | 2209878 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 11 | 174146 | 174424 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 12 | 2617192 | 2617470 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 13 | 1958011 | 1958319 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 14 | 373750 | 374037 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 15 | 143040 | 143324 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 16 | 2170009 | 2170287 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 17 | 2287459 | 2287737 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 18 | 3152212 | 3152499 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 19 | 3075372 | 3075644 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 20 | 5622825 | 5623112 | - | NZ_CP039126.1 | Blautia producta |
| 21 | 1958330 | 1958608 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 22 | 153718 | 153999 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 23 | 2861794 | 2862060 | - | NZ_LR699011.1 | Roseburia hominis |
| 24 | 188287 | 188568 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 25 | 3763771 | 3764058 | - | NZ_CP028842.1 | Clostridium botulinum |
| 26 | 4044792 | 4045079 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 27 | 2810696 | 2810980 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 28 | 2891609 | 2891893 | - | NZ_CP030280.1 | Blautia argi |
| 29 | 1534541 | 1534825 | + | NC_023035.1 | Salinispira pacifica |
| 30 | 3743535 | 3743801 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 31 | 1936260 | 1936523 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 32 | 2463420 | 2463695 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 33 | 1983512 | 1983778 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 34 | 2480167 | 2480448 | - | NZ_LN879430.1 | Herbinix luporum |
| 35 | 165357 | 165665 | + | NZ_LT906444.1 | Listeria welshimeri |
| 36 | 200522 | 200830 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 37 | 135810 | 136100 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 38 | 2147145 | 2147444 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 39 | 2752391 | 2752678 | - | NZ_HG917868.1 | Clostridium bornimense |
| 40 | 1745541 | 1745825 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 41 | 2724860 | 2725150 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 42 | 4591589 | 4591867 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 43 | 146427 | 146708 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 44 | 2962234 | 2962521 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 45 | 2154012 | 2154302 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 46 | 4521242 | 4521532 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 47 | 81916 | 82212 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 48 | 1823824 | 1824111 | - | NZ_CP070062.1 | Coprococcus comes |
| 49 | 5372717 | 5373007 | - | NZ_CP020953.1 | Clostridium drakei |
| 50 | 4516057 | 4516347 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 51 | 4551455 | 4551745 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 52 | 884584 | 884838 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 53 | 3518923 | 3519219 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 54 | 3450794 | 3451084 | - | NZ_CP040924.1 | Clostridium thermarum |
| 55 | 103929 | 104234 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 56 | 2474553 | 2474834 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 57 | 2035820 | 2036083 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 58 | 2505125 | 2505391 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 59 | 175817 | 176125 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 60 | 237822 | 238130 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 61 | 540453 | 540740 | + | NZ_CP014176.1 | Clostridium argentinense |
| 62 | 3321884 | 3322141 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 63 | 2350963 | 2351253 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 64 | 389695 | 389991 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 65 | 5069106 | 5069399 | - | NZ_CP040336.1 | Bacillus luti |
| 66 | 50911 | 51204 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 67 | 50175 | 50468 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 68 | 50145 | 50438 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 69 | 133822 | 134124 | + | NC_008593.1 | Clostridium novyi NT |
| 70 | 189753 | 190028 | + | NZ_CP014204.2 | Clostridium baratii |
| 71 | 2685432 | 2685713 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 72 | 343775 | 344062 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 73 | 4653338 | 4653634 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 74 | 2513055 | 2513363 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 75 | 56076 | 56366 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 76 | 4013428 | 4013715 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 77 | 1067796 | 1068068 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 78 | 236915 | 237199 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 79 | 485546 | 485848 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 80 | 52590 | 52883 | + | NZ_LS483476.1 | Lederbergia lentus |
| 81 | 25515 | 25790 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 82 | 50523 | 50816 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 83 | 50418 | 50711 | + | NC_011725.1 | Bacillus cereus B4264 |
| 84 | 3374577 | 3374864 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 85 | 155137 | 155421 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 86 | 158631 | 158912 | + | NZ_CP016786.1 | Clostridium isatidis |
| 87 | 1683218 | 1683514 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 88 | 1919703 | 1919987 | + | NZ_CP023671.1 | Clostridium septicum |
| 89 | 3110726 | 3111007 | + | NC_015578.1 | Treponema primitia ZAS-2 |
| 90 | 1736194 | 1736475 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 91 | 63412 | 63675 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 92 | 54053 | 54343 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 93 | 2747653 | 2747943 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 94 | 2342002 | 2342292 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 95 | 429122 | 429412 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 96 | 3175357 | 3175647 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 97 | 561021 | 561311 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 98 | 1680176 | 1680472 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 99 | 218546 | 218836 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 100 | 122673 | 122951 | + | NZ_CP019870.1 | Clostridioides difficile |
| 101 | 20491 | 20775 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009170.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13793.8 | 0.79 | 80 | 1557.5 | same-strand | N-terminal domain of ribose phosphate pyrophosphokinase |
| 2 | PF00132.26 | 0.8 | 81 | 162 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 3 | PF00483.25 | 0.79 | 80 | 184.0 | same-strand | Nucleotidyl transferase |
| 4 | PF14602.8 | 0.6 | 61 | 184 | same-strand | Hexapeptide repeat of succinyl-transferase |
| 5 | PF09182.12 | 0.6 | 61 | 177 | same-strand | Bacterial purine repressor, N-terminal |
++ More..