Result : Q1D0P6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000113.1 |
| Organism | Myxococcus xanthus (strain DK 1622) |
| Left | 7004307 |
| Right | 7004606 |
| Strand | + |
| Nucleotide Sequence | ATGGGGCAGTCCATGAGTGGCACGCGGCGAGCCTCGCTGCGCATCGAAGGCAAGGTGCAGGGCGTCTTCTTCAGGGAGAGCGCCCGCGTTGAAGCCACACGCCTGGGCCTGACAGGCTGGGTGCGCAACCGGCCGGACGGGGCCGTGGAGGCCGTCGTGGAAGGGGAGCCCGCCGTGCTCGAGGAATTCATCCACTGGTGTCATCGCGGTCCGGCGCAGGCCCGGGTTTCGGGCGTTCAGCGCACGGACAGCAAGGCCACCGGCGAGTTCAGTCAATTCAACGTGGAGCGCACGTCATGA |
| Sequence | MGQSMSGTRRASLRIEGKVQGVFFRESARVEATRLGLTGWVRNRPDGAVEAVVEGEPAVLEEFIHWCHRGPAQARVSGVQRTDSKATGEFSQFNVERTS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17015832 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q1D0P6 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 7004307 | 7004606 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 2 | 1490551 | 1490850 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 3 | 6826320 | 6826619 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 4 | 8079328 | 8079573 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 5 | 7727867 | 7728154 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 6 | 1539702 | 1539947 | + | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 7 | 1092855 | 1093133 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 8 | 9041170 | 9041424 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 9 | 1447065 | 1447325 | + | NZ_CP013011.1 | Pyrodictium delaneyi |
| 10 | 2131424 | 2131672 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 11 | 1110089 | 1110367 | - | NZ_CP024808.1 | Candidatus Nitrosotenuis aquarius |
| 12 | 1130966 | 1131211 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 13 | 325427 | 325705 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 14 | 120517 | 120795 | + | NZ_CP011097.1 | Candidatus Nitrosotenuis cloacae |
| 15 | 442086 | 442328 | + | NC_014961.1 | Desulfurococcus mucosus DSM 2162 |
| 16 | 375757 | 376038 | + | NC_010482.1 | Candidatus Korarchaeum cryptofilum OPF8 |
| 17 | 1896486 | 1896761 | + | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 18 | 598524 | 598775 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 19 | 831081 | 831368 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 20 | 1234749 | 1235000 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 21 | 276873 | 277160 | + | NZ_CP023154.1 | Pyrococcus furiosus DSM 3638 |
| 22 | 893046 | 893327 | - | NZ_CP009961.1 | Infirmifilum uzonense |
| 23 | 1792169 | 1792420 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 24 | 1020633 | 1020908 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 25 | 1008960 | 1009202 | + | NC_000854.2 | Aeropyrum pernix K1 |
| 26 | 1210843 | 1211130 | + | NC_015680.1 | Pyrococcus yayanosii CH1 |
| 27 | 1520142 | 1520444 | - | NZ_CP015101.1 | Thermococcus barossii |
| 28 | 957425 | 957667 | + | NC_022521.1 | Aeropyrum camini SY1 = JCM 12091 |
| 29 | 979627 | 979902 | - | NZ_CP007140.1 | Thermococcus guaymasensis DSM 11113 |
| 30 | 1643552 | 1643818 | - | NC_000868.1 | Pyrococcus abyssi GE5 |
| 31 | 35519 | 35785 | + | NC_022084.1 | Thermococcus litoralis DSM 5473 |
| 32 | 456508 | 456783 | + | NZ_LN999010.1 | Thermococcus chitonophagus |
| 33 | 1319368 | 1319643 | - | NC_014804.1 | Thermococcus barophilus MP |
| 34 | 174596 | 174871 | - | NZ_CP010835.1 | Pyrococcus kukulkanii |
| 35 | 2379247 | 2379507 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 36 | 1428967 | 1429242 | - | NZ_CP006965.1 | Thermococcus paralvinellae |
| 37 | 1059461 | 1059736 | + | NC_012883.1 | Thermococcus sibiricus MM 739 |
| 38 | 291851 | 292126 | - | NZ_CP006019.1 | Palaeococcus pacificus DY20341 |
| 39 | 2358767 | 2359009 | - | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 40 | 380841 | 381089 | - | NZ_CP027792.1 | Pulveribacter suum |
| 41 | 270758 | 271033 | + | NC_000961.1 | Pyrococcus horikoshii OT3 |
| 42 | 6477769 | 6478020 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 43 | 1672254 | 1672547 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 44 | 1757034 | 1757291 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 45 | 224323 | 224610 | + | NC_010525.1 | Pyrobaculum neutrophilum V24Sta |
| 46 | 1296467 | 1296754 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 47 | 3737545 | 3737805 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 48 | 892253 | 892519 | + | NZ_CP015520.1 | Thermococcus piezophilus |
| 49 | 453127 | 453408 | - | NZ_CP062310.1 | Infirmifilum lucidum |
| 50 | 2248052 | 2248294 | + | NZ_CP014646.1 | Thauera humireducens |
| 51 | 263125 | 263391 | - | NC_009376.1 | Pyrobaculum arsenaticum DSM 13514 |
| 52 | 2552852 | 2553097 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 53 | 1430462 | 1430710 | + | NC_015514.1 | Cellulomonas fimi ATCC 484 |
| 54 | 111857 | 112165 | + | NZ_CP064781.1 | Azospira restricta |
| 55 | 505642 | 505914 | + | NZ_CP012154.1 | Wenzhouxiangella marina |
++ More..