Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein ZapB |
NCBI Accession ID | CP000753.1 |
Organism | Shewanella baltica (strain OS185) |
Left | 4816886 |
Right | 4817107 |
Strand | + |
Nucleotide Sequence | ATGAGCCTTGAATTACTGTCCAAACTGGAAACCAAAATCCAGGCTGCACTCGAAACTATCGAGCTTCTAAAAATGGAGCTTGAAGAAGAGAAGCAAAAAGCGTCTACGCTGAGTGAGCACAATCAACAATTGAATGCGCAAAACCAGCAACTACAAGAAGAACTCACTTCTTGGAACGAAAAAGTGACTGGCCTTGTTGGCTTGTTAAACAGCGAAATCTAA |
Sequence | MSLELLSKLETKIQAALETIELLKMELEEEKQKASTLSEHNQQLNAQNQQLQEELTSWNEKVTGLVGLLNSEI |
Source of smORF | Swiss-Prot |
Function | Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA. {ECO:0000255|HAMAP-Rule:MF_01196}. |
Pubmed ID | |
Domain | CDD:416309 |
Functional Category | Others |
Uniprot ID | A6WTL2 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4859769 | 4859990 | + | NC_016901.1 | Shewanella baltica OS678 |
2 | 790995 | 791216 | - | NZ_CP034015.1 | Shewanella livingstonensis |
3 | 446145 | 446366 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
4 | 4530023 | 4530226 | + | NC_014012.1 | Shewanella violacea DSS12 |
5 | 430856 | 431077 | - | NZ_CP041036.1 | Shewanella polaris |
6 | 3867668 | 3867871 | + | NZ_CP069213.1 | Shewanella litorisediminis |
7 | 3557906 | 3558112 | - | NZ_CP037951.1 | Parashewanella tropica |
8 | 285155 | 285361 | - | NC_009092.1 | Shewanella loihica PV-4 |
9 | 262373 | 262579 | - | NZ_CP022272.1 | Shewanella marisflavi |
10 | 5151325 | 5151528 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
11 | 634813 | 635022 | - | NZ_CP037952.1 | Parashewanella spongiae |
12 | 3721849 | 3722052 | + | NZ_CP014782.1 | Shewanella psychrophila |
13 | 498178 | 498381 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
14 | 333451 | 333672 | - | NZ_CP022358.1 | Shewanella bicestrii |
15 | 2973397 | 2973597 | - | NZ_CP036200.1 | Shewanella maritima |
16 | 322152 | 322352 | - | NC_007954.1 | Shewanella denitrificans OS217 |
17 | 3708931 | 3709134 | + | NZ_CP020373.1 | Shewanella khirikhana |
18 | 3949192 | 3949395 | + | NC_008700.1 | Shewanella amazonensis SB2B |
19 | 2843306 | 2843506 | + | NZ_CP041783.1 | Shewanella donghaensis |
20 | 4543466 | 4543666 | + | NZ_CP020472.1 | Shewanella japonica |
21 | 4850725 | 4850928 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
22 | 350796 | 350999 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
23 | 2267618 | 2267821 | - | NC_011566.1 | Shewanella piezotolerans WP3 |
24 | 4579793 | 4579996 | + | NZ_CP046378.1 | Shewanella algae |
25 | 4134897 | 4135124 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06526.14 | 1.0 | 25 | 19 | opposite-strand | Protein of unknown function (DUF1107) |
2 | PF01323.22 | 0.92 | 23 | 660 | opposite-strand | DSBA-like thioredoxin domain |
3 | PF13462.8 | 0.96 | 24 | 660 | opposite-strand | Thioredoxin |
4 | PF01636.25 | 0.96 | 24 | 1406.5 | opposite-strand | Phosphotransferase enzyme family |
5 | PF12305.10 | 0.96 | 24 | 2458.0 | opposite-strand | Protein of unknown function (DUF3630) |