Result : Q1CRC4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000241.1 |
| Organism | Helicobacter pylori (strain HPAG1) |
| Left | 1488173 |
| Right | 1488433 |
| Strand | + |
| Nucleotide Sequence | ATGCAAGATGAATTATTTGAAACCGAAAAAGCCCCCCAAAAAAATACTAAGAACGCTAAAAACGCCCCTAAAAAAAGCTTTGAAGAGCATGTTCATTCCCTAGAGCAAGCCATAGATCGCTTGAATGATCCCAATTTGTCCTTAAAAGACGGGATGGATTTGTATAAAACGGCCATGCAAGAATTGGTTTTGGCTCAAAAGCTTTTAGAAAACGCTTATTTGGAGTATGAAAAACTCCAAACGCTAGACAAAAAGGCTTAA |
| Sequence | MQDELFETEKAPQKNTKNAKNAPKKSFEEHVHSLEQAIDRLNDPNLSLKDGMDLYKTAMQELVLAQKLLENAYLEYEKLQTLDKKA |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 16788065 |
| Domain | CDD:412547,CDD:184484 |
| Functional Category | Others |
| Uniprot ID | Q1CRC4 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1514106 | 1514366 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 2 | 1518063 | 1518314 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 3 | 907253 | 907507 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008229.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13144.8 | 1.0 | 3 | 6641 | same-strand | Chaperone for flagella basal body P-ring formation |
| 2 | PF13361.8 | 1.0 | 3 | 4599 | same-strand | UvrD-like helicase C-terminal domain |
| 3 | PF13245.8 | 1.0 | 3 | 4599 | same-strand | AAA domain |
| 4 | PF13538.8 | 1.0 | 3 | 4599 | same-strand | UvrD-like helicase C-terminal domain |
| 5 | PF13604.8 | 0.67 | 2 | 4599.5 | same-strand | AAA domain |
| 6 | PF00587.27 | 1.0 | 3 | 802 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 7 | PF02403.24 | 1.0 | 3 | 802 | same-strand | Seryl-tRNA synthetase N-terminal domain |
| 8 | PF00795.24 | 1.0 | 3 | 4 | same-strand | Carbon-nitrogen hydrolase |
| 9 | PF01209.20 | 1.0 | 3 | 12 | same-strand | ubiE/COQ5 methyltransferase family |
| 10 | PF08241.14 | 1.0 | 3 | 12 | same-strand | Methyltransferase domain |
| 11 | PF13649.8 | 1.0 | 3 | 12 | same-strand | Methyltransferase domain |
| 12 | PF13489.8 | 1.0 | 3 | 12 | same-strand | Methyltransferase domain |
| 13 | PF08242.14 | 1.0 | 3 | 12 | same-strand | Methyltransferase domain |
| 14 | PF03653.15 | 1.0 | 3 | 762 | same-strand | Uncharacterised protein family (UPF0093) |
| 15 | PF05425.15 | 1.0 | 3 | 762 | same-strand | Copper resistance protein D |
| 16 | PF12698.9 | 1.0 | 3 | 2356.5 | same-strand | ABC-2 family transporter protein |
| 17 | PF01205.21 | 0.67 | 2 | 1219.0 | same-strand | Uncharacterized protein family UPF0029 |
++ More..