Result : Q1BG50
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein CrgA |
| NCBI Accession ID | CP000384.1 |
| Organism | Mycobacterium sp. (strain MCS) |
| Left | 14951 |
| Right | 15235 |
| Strand | - |
| Nucleotide Sequence | ATGCCCAAGTCGAAGGTCCGCAAGAAGAACGACTTCACCATCAGTCCGGTCAGCCGGACGCCGGTGAAGGTGAAGGCCGGCCCGTCGAGCGTGTGGTTCGTCGCCCTGTTCGTCGGGCTGATGCTCATCGGGTTGATCTGGCTGCTGGTGTTCCAGCTCGCCGCGACCAACCCGGTCGACGCACCCGGGATGCTGCAGTGGATGGCCGACCTCGGCCCGTGGAACTACGCGATCGCTTTTGCCTTCATGATCACGGGTCTGTTGCTCACGATGCGGTGGCGCTGA |
| Sequence | MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGLIWLLVFQLAATNPVDAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR |
| Source of smORF | Swiss-Prot |
| Function | Involved in cell division. {ECO:0000255|HAMAP-Rule:MF_00631}. |
| Pubmed ID | |
| Domain | CDD:416303 |
| Functional Category | Others |
| Uniprot ID | Q1BG50 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 129
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4897131 | 4897415 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 2 | 4370468 | 4370752 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 3 | 3898387 | 3898671 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 4 | 48029 | 48313 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 5 | 7545100 | 7545384 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 6 | 1320372 | 1320656 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 7 | 2481105 | 2481389 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 8 | 5664846 | 5665130 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 9 | 1569498 | 1569779 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 10 | 3361400 | 3361681 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 11 | 3469338 | 3469622 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 12 | 3744830 | 3745114 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 13 | 14381 | 14665 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 14 | 4015084 | 4015365 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 15 | 4441398 | 4441679 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 16 | 2354784 | 2355065 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 17 | 26053 | 26334 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 18 | 605842 | 606123 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 19 | 3259736 | 3260017 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 20 | 15480 | 15761 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 21 | 828480 | 828761 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 22 | 5829366 | 5829647 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 23 | 1545281 | 1545562 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 24 | 22876 | 23157 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 25 | 13054 | 13335 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 26 | 3675591 | 3675872 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 27 | 17559 | 17840 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 28 | 16274 | 16555 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 29 | 16276 | 16557 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 30 | 4378319 | 4378600 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 31 | 659835 | 660116 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 32 | 14798 | 15079 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 33 | 4005031 | 4005312 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 34 | 1497951 | 1498232 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 35 | 2663320 | 2663601 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 36 | 3629396 | 3629680 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 37 | 15003 | 15284 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 38 | 1831033 | 1831314 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 39 | 1469525 | 1469809 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 40 | 23369 | 23650 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 41 | 4290350 | 4290631 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 42 | 5771296 | 5771577 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 43 | 16430 | 16714 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 44 | 16022 | 16303 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 45 | 23155 | 23436 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 46 | 4207572 | 4207853 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 47 | 17138 | 17419 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 48 | 3886353 | 3886634 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 49 | 15583 | 15846 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 50 | 2182734 | 2183015 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 51 | 1320787 | 1321071 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 52 | 480910 | 481173 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 53 | 4095788 | 4096069 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 54 | 3564929 | 3565210 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 55 | 13714 | 13995 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 56 | 13661 | 13942 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 57 | 1311696 | 1311980 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 58 | 13184 | 13465 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 59 | 4535523 | 4535804 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 60 | 5488161 | 5488424 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 61 | 2866266 | 2866547 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 62 | 1452107 | 1452388 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 63 | 4401499 | 4401762 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 64 | 1766121 | 1766384 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 65 | 2317228 | 2317491 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 66 | 4259883 | 4260146 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 67 | 3549781 | 3550065 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 68 | 1884853 | 1885137 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 69 | 24244 | 24507 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 70 | 32889 | 33152 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 71 | 30866 | 31129 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 72 | 29829 | 30092 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 73 | 28004 | 28267 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 74 | 52918 | 53181 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 75 | 4473475 | 4473744 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 76 | 14177 | 14458 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 77 | 1944275 | 1944556 | + | NZ_AP022562.1 | Mycobacterium novum |
| 78 | 14420 | 14701 | - | NC_015576.1 | Mycolicibacter sinensis |
| 79 | 58400 | 58663 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 80 | 12528 | 12809 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 81 | 550866 | 551147 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 82 | 36056 | 36319 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 83 | 21514 | 21777 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 84 | 6981801 | 6982067 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 85 | 1933114 | 1933377 | - | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 86 | 4396638 | 4396901 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 87 | 6517854 | 6518117 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 88 | 793183 | 793446 | - | NZ_LR134352.1 | Nocardia asteroides |
| 89 | 17307 | 17570 | - | NZ_CP018082.1 | Nocardia mangyaensis |
| 90 | 93896 | 94174 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 91 | 29573 | 29836 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 92 | 21645 | 21911 | - | NZ_AP017900.1 | Nocardia seriolae |
| 93 | 29695 | 29961 | - | NZ_AP023396.1 | Nocardia wallacei |
| 94 | 3856795 | 3857079 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 95 | 2804105 | 2804371 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 96 | 1675525 | 1675791 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 97 | 25511 | 25804 | - | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 98 | 352754 | 353050 | - | NZ_CP027433.1 | Gordonia iterans |
| 99 | 3959648 | 3959938 | - | NZ_CP033972.1 | Gordonia insulae |
| 100 | 25438 | 25731 | - | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 101 | 1020939 | 1021229 | - | NZ_CP059694.1 | Gordonia rubripertincta |
| 102 | 306253 | 306525 | + | NC_014168.1 | Segniliparus rotundus DSM 44985 |
| 103 | 23537 | 23827 | - | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 104 | 644098 | 644361 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 105 | 45614 | 45877 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 106 | 19161 | 19451 | - | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 107 | 23748 | 24014 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 108 | 21089 | 21355 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 109 | 980629 | 980919 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 110 | 26603 | 26866 | - | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 111 | 54265 | 54531 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 112 | 2884222 | 2884488 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 113 | 6480893 | 6481159 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 114 | 27612 | 27878 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 115 | 28806 | 29072 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 116 | 22144 | 22413 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 117 | 17664 | 17930 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 118 | 27733 | 27999 | - | NZ_CP008953.1 | Amycolatopsis japonica |
| 119 | 36893 | 37159 | - | NZ_CP016353.1 | Prauserella marina |
| 120 | 9467365 | 9467631 | + | NZ_CP016174.1 | Amycolatopsis orientalis |
| 121 | 3502992 | 3503258 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 122 | 6240955 | 6241221 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 123 | 17105 | 17371 | - | NZ_CP023445.1 | Actinosynnema pretiosum |
| 124 | 18217 | 18483 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 125 | 17118 | 17384 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 126 | 42225 | 42491 | - | NC_022116.1 | Amycolatopsis mediterranei RB |
| 127 | 1540581 | 1540850 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 128 | 17290 | 17556 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 129 | 25206 | 25469 | - | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022617.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00905.24 | 0.73 | 94 | 4751.5 | same-strand | Penicillin binding protein transpeptidase domain |
| 2 | PF00069.27 | 0.88 | 114 | 2781 | same-strand | Protein kinase domain |
| 3 | PF07714.19 | 0.88 | 114 | 2781 | same-strand | Protein tyrosine and serine/threonine kinase |
| 4 | PF03793.21 | 0.88 | 114 | 1580.5 | same-strand | PASTA domain |
| 5 | PF00117.30 | 0.95 | 123 | 910 | opposite-strand | Glutamine amidotransferase class-I |
| 6 | PF05949.14 | 0.69 | 89 | 111 | opposite-strand | Bacterial protein of unknown function (DUF881) |
| 7 | PF10756.11 | 0.94 | 121 | 156 | same-strand | Bacterial PH domain |
| 8 | PF00160.23 | 0.94 | 121 | 639 | opposite-strand | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD |
++ More..