Result : Q1B548
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000384.1 |
| Organism | Mycobacterium sp. (strain MCS) |
| Left | 4134613 |
| Right | 4134858 |
| Strand | - |
| Nucleotide Sequence | ATGGATCCCACAATCGCTGCCGGCGCGCTCATCGGCGGTGGACTCATCATGGCCGGCGGTGCGATCGGTGCCGGTATCGGTGACGGTATCGCCGGTAACGCGCTGATCGCCGGTATCGCCCGCCAGCCGGAGGCCCAGGGTCGCCTGTTCACGCCGTTCTTCATCACGGTCGGTCTGGTGGAGGCCGCGTACTTCATCAACCTGGCGTTCATGGCGCTGTTCGTCTTCGCAACCCCGGTCGCTTAG |
| Sequence | MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q1B548 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 615371 | 615616 | - | NZ_AP022562.1 | Mycobacterium novum |
| 2 | 2781518 | 2781763 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 3 | 417355 | 417600 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 4 | 741576 | 741821 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 5 | 5422253 | 5422498 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 6 | 1388810 | 1389055 | + | NC_015576.1 | Mycolicibacter sinensis |
| 7 | 5258195 | 5258440 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 8 | 2510453 | 2510698 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 9 | 82838 | 83083 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 10 | 6192038 | 6192283 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 11 | 1017095 | 1017340 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 12 | 4260495 | 4260740 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 13 | 2112166 | 2112411 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 14 | 3505770 | 3506015 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 15 | 2052372 | 2052572 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 16 | 21069 | 21269 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 17 | 2403498 | 2403698 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 18 | 4767380 | 4767580 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 19 | 1373903 | 1374103 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 20 | 575430 | 575675 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 21 | 1320193 | 1320438 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 22 | 1461045 | 1461290 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 23 | 1485512 | 1485757 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 24 | 4093452 | 4093697 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 25 | 1425659 | 1425904 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 26 | 5009019 | 5009264 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 27 | 1298646 | 1298891 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 28 | 1931253 | 1931498 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 29 | 3020019 | 3020264 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 30 | 1435979 | 1436179 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 31 | 1292570 | 1292770 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 32 | 1304973 | 1305173 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 33 | 2612570 | 2612788 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 34 | 1392437 | 1392637 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 35 | 2793321 | 2793551 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 36 | 1419995 | 1420195 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 37 | 2839601 | 2839831 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 38 | 1565529 | 1565729 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 39 | 3125281 | 3125511 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 40 | 3853608 | 3853808 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 41 | 3923470 | 3923667 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 42 | 290099 | 290299 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 43 | 1284373 | 1284618 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 44 | 2382391 | 2382600 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 45 | 1418657 | 1418902 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 46 | 5207884 | 5208081 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 47 | 2680466 | 2680666 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 48 | 2565969 | 2566169 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 49 | 1359184 | 1359384 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 50 | 1628537 | 1628737 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 51 | 1383355 | 1383555 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 52 | 5474989 | 5475186 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 53 | 4182582 | 4182779 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 54 | 4199575 | 4199772 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 55 | 1374636 | 1374836 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 56 | 2853335 | 2853535 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 57 | 4652378 | 4652623 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 58 | 2794150 | 2794404 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 59 | 332752 | 332997 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 60 | 4172558 | 4172809 | - | NZ_CP059694.1 | Gordonia rubripertincta |
| 61 | 4043227 | 4043478 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 62 | 5580239 | 5580487 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 63 | 3841674 | 3841919 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 64 | 5423952 | 5424206 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 65 | 4337910 | 4338164 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 66 | 5281280 | 5281486 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 67 | 2272559 | 2272759 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 68 | 3154651 | 3154857 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 69 | 5951401 | 5951598 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 70 | 4468422 | 4468628 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 71 | 4318889 | 4319149 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 72 | 3341761 | 3342021 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 73 | 5044631 | 5044837 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 74 | 206153 | 206359 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 75 | 4716297 | 4716494 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 76 | 1074263 | 1074523 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 77 | 5800168 | 5800425 | + | NZ_AP023396.1 | Nocardia wallacei |
| 78 | 2054187 | 2054450 | + | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 79 | 8567352 | 8567609 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 80 | 673743 | 673988 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 81 | 1725619 | 1725864 | - | NZ_CP044344.1 | Nocardioides cynanchi |
| 82 | 700464 | 700727 | + | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 83 | 1755170 | 1755415 | + | NZ_CP059164.1 | Nocardioides ungokensis |
| 84 | 3002893 | 3003090 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 85 | 380075 | 380287 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 86 | 1145478 | 1145693 | - | NZ_CP021434.1 | Tumebacillus avium |
| 87 | 4001100 | 4001300 | - | NZ_CP053352.1 | Winogradskyella helgolandensis |
| 88 | 4345804 | 4346004 | + | NZ_CP053348.1 | Winogradskyella forsetii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022562.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 0.97 | 78 | 2041.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 0.97 | 78 | 2041.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00231.21 | 0.97 | 78 | 3592.0 | same-strand | ATP synthase |
| 4 | PF00306.29 | 0.97 | 78 | 1935.5 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 5 | PF00213.20 | 0.97 | 78 | 541.0 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00430.20 | 1.0 | 80 | 73 | same-strand | ATP synthase B/B' CF(0) |
| 7 | PF00119.22 | 1.0 | 80 | 95.5 | same-strand | ATP synthase A chain |
| 8 | PF03899.17 | 0.93 | 74 | 880.0 | same-strand | ATP synthase I chain |
| 9 | PF00953.23 | 0.91 | 73 | 1582 | same-strand | Glycosyl transferase family 4 |
| 10 | PF01300.20 | 0.88 | 70 | 2834.0 | same-strand | Telomere recombination |
| 11 | PF17827.3 | 0.78 | 62 | 3497.0 | same-strand | PrmC N-terminal domain |
++ More..