Result : Q1AVU9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000386.1 |
| Organism | Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) |
| Left | 1536594 |
| Right | 1536848 |
| Strand | + |
| Nucleotide Sequence | GTGCCTGCACCCACCAAGCGCGAGCGGCAGAACAGAAAGCGTTTCGAGCGCAACCGCAGCGTGAGGACGCGCCTGCGCAACCTGTCGAAGAAGTTCTACCGGGCGCTGGACGCGGGGGACCTGGAGAGTGCCCGGAGCGTGAGGGACGAGGCGCAGAAGGCCTACGACAAGGCCGCGGGCAAGGGGATCATCCACCGCAACAAGGCCTCCCGCAAGCTGAGCCGGTTCGACCGCGCGCTGGCCGGCAGGGGCTGA |
| Sequence | MPAPTKRERQNRKRFERNRSVRTRLRNLSKKFYRALDAGDLESARSVRDEAQKAYDKAAGKGIIHRNKASRKLSRFDRALAGRG |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1AVU9 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1536594 | 1536848 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 2 | 1598378 | 1598641 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 3 | 1534105 | 1534371 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 4 | 1432771 | 1433031 | - | NZ_CP036250.1 | Egicoccus halophilus |
| 5 | 1584105 | 1584371 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008148.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09424.12 | 0.6 | 3 | 5052 | opposite-strand | Yqey-like protein |
| 2 | PF04452.16 | 0.6 | 3 | 4277 | opposite-strand | RNA methyltransferase |
| 3 | PF01556.20 | 0.6 | 3 | 3110 | opposite-strand | DnaJ C terminal domain |
| 4 | PF00226.33 | 0.6 | 3 | 3110 | opposite-strand | DnaJ domain |
| 5 | PF00684.21 | 0.6 | 3 | 3110 | opposite-strand | DnaJ central domain |
| 6 | PF01628.23 | 0.6 | 3 | 2062 | opposite-strand | HrcA protein C terminal domain |
| 7 | PF03444.17 | 0.6 | 3 | 2062 | opposite-strand | Winged helix-turn-helix transcription repressor, HrcA DNA-binding |
| 8 | PF06421.14 | 0.6 | 3 | 82 | opposite-strand | GTP-binding protein LepA C-terminus |
| 9 | PF00009.29 | 0.6 | 3 | 82 | opposite-strand | Elongation factor Tu GTP binding domain |
| 10 | PF00679.26 | 0.6 | 3 | 82 | opposite-strand | Elongation factor G C-terminus |
| 11 | PF03144.27 | 0.6 | 3 | 82 | opposite-strand | Elongation factor Tu domain 2 |
| 12 | PF01926.25 | 0.6 | 3 | 82 | opposite-strand | 50S ribosome-binding GTPase |
| 13 | PF06144.15 | 1.0 | 5 | 77 | opposite-strand | DNA polymerase III, delta subunit |
| 14 | PF03772.18 | 0.6 | 3 | 1039 | opposite-strand | Competence protein |
| 15 | PF13567.8 | 0.6 | 3 | 1039 | opposite-strand | Domain of unknown function (DUF4131) |
| 16 | PF12836.9 | 0.6 | 3 | 2654 | opposite-strand | Helix-hairpin-helix motif |
| 17 | PF02410.17 | 0.6 | 3 | 3341 | opposite-strand | Ribosomal silencing factor during starvation |
| 18 | PF01467.28 | 0.6 | 3 | 3759 | opposite-strand | Cytidylyltransferase-like |
++ More..