Result : Q1AVU1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | CP000386.1 |
| Organism | Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) |
| Left | 1542526 |
| Right | 1542813 |
| Strand | - |
| Nucleotide Sequence | ATGTATGCGGTCGTAAAGAGCGGCGGAAAGCAGTACAGGGTGCGTCAGGGCGACGAGCTGCTCGTGGAGCGGCTCGCCGGCGAGGTCGGCGACCGGGTCGAGCTACCGGTGAGCCTGCGGGCGGAGGAGGGGGTCCTCGACCTCGAGCCCCGCACCGCGCGGGCCGAGATCCTGGAGCACCTGCGGGGAGAGAAGCTGAAGGTGTACAAGTACAAGCCCAAGAAGGGCTACCGGAGAAAGAAGGGGCACAGGCAGGCCCTGACCCGGATAAGAGTGGTGGAGGTTTAG |
| Sequence | MYAVVKSGGKQYRVRQGDELLVERLAGEVGDRVELPVSLRAEEGVLDLEPRTARAEILEHLRGEKLKVYKYKPKKGYRRKKGHRQALTRIRVVEV |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q1AVU1 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1542526 | 1542813 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 2 | 1540472 | 1540720 | - | NZ_CP031115.1 | Rubrobacter indicoceani |
| 3 | 1604732 | 1604965 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 4 | 4184674 | 4184982 | - | NZ_CP042430.1 | Baekduia soli |
| 5 | 251560 | 251850 | + | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 6 | 2843600 | 2843944 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 7 | 1862981 | 1863295 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 8 | 1214249 | 1214554 | + | NZ_CP016312.1 | Thermus brockianus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008148.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01018.24 | 0.88 | 7 | 341 | same-strand | GTP1/OBG |
| 2 | PF01926.25 | 0.88 | 7 | 341 | same-strand | 50S ribosome-binding GTPase |
| 3 | PF09269.13 | 0.88 | 7 | 341 | same-strand | Domain of unknown function (DUF1967) |
| 4 | PF01016.21 | 1.0 | 8 | 6.0 | same-strand | Ribosomal L27 protein |
| 5 | PF01098.21 | 0.62 | 5 | 1964 | same-strand | Cell cycle protein |
| 6 | PF04093.14 | 0.62 | 5 | 4436 | same-strand | rod shape-determining protein MreD |
| 7 | PF04085.16 | 0.62 | 5 | 5096 | same-strand | rod shape-determining protein MreC |
++ More..