| Protein name |
4-hydroxyphenylacetate decarboxylase small subunit (HPA decarboxylase small subunit) (EC 4.1.1.83) (4-hydroxyphenylacetate decarboxylase gamma subunit) (p-hydroxyphenylacetate decarboxylase small subunit) |
| NCBI Accession ID |
AM180355.1 |
| Organism |
Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Left |
204752 |
| Right |
205009 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAGAAAGCATAGTGATTGTATGAATTTTTGTGCAGTGGATGCAACCAAAGGAATTTGTAGATTATCAAAACAAATGATTAATTTAGATGATGCAGCATGTCCAGAGATAAAAGTAATGCCAAAATGTAAAAATTGTAAAAATTTTGTTGAAGCTAATGATGAAGGTATAGGCAAATGTGTTGGCCTAGAGAAAGAAGACTGGGTATATTCAACATTGAATGCAATTACTTGTGAAGGACATGTGTTTAATGAGTAG |
| Sequence |
MRKHSDCMNFCAVDATKGICRLSKQMINLDDAACPEIKVMPKCKNCKNFVEANDEGIGKCVGLEKEDWVYSTLNAITCEGHVFNE |
| Source of smORF |
Swiss-Prot |
| Function |
Component of the HPA decarboxylase that decarboxylates phenylacetates with a hydroxyl group in the p-position. Active toward 4-hydroxyphenylacetate and 3,4-dihydroxyphenylacetate, forming 4-methylphenol and 4-methylcatechol, respectively. Is likely involved in the catabolism of aromatic amino acids such as tyrosine fermentation. 4-methylphenol (p-cresol) formation provides metabolic toxicity, which allows an active suppression of other microbes and may provide growth advantages for the producers in highly competitive environments (By similarity). The small subunit is essential for enzymatic activity of HPA decarboxylase, and seems also involved in the regulation of the enzyme oligomeric state and catalytic activity (By similarity). {ECO:0000250|UniProtKB:Q38HX3, ECO:0000250|UniProtKB:Q84F15}. |
| Pubmed ID |
16804543
|
| Domain |
CDD:408311,CDD:411304,CDD:408452 |
| Functional Category |
Metal-binding |
| Uniprot ID |
Q18CP4
|
| ORF Length (Amino Acid) |
85 |