Result : Q18CH8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | AM180355.1 |
| Organism | Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Left | 111238 |
| Right | 111423 |
| Strand | + |
| Nucleotide Sequence | ATGGCTAAATTACAAATAAAGTTAGTTAGAAGTGTTATAGGAACTACTCCTAACCAAAAAAAGAATGTTGAAGCGTTAGGATTAAGAAAAAGAGAACAAGTTGTTGTAAAAGAAGACAATGCTCAAACAAGAGGTATGATAAATAAAGTAAGTCACTTATTAGAAGTAACTGAAATAGCTGAATAA |
| Sequence | MAKLQIKLVRSVIGTTPNQKKNVEALGLRKREQVVVKEDNAQTRGMINKVSHLLEVTEIAE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 16804543 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q18CH8 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 527
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3946501 | 3946686 | - | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 89902 | 90087 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 3 | 28654 | 28839 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 4 | 150429 | 150608 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 5 | 156871 | 157056 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 6 | 3627321 | 3627500 | - | NZ_CP033433.1 | Cohnella candidum |
| 7 | 2300503 | 2300682 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 8 | 179141 | 179320 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 9 | 207849 | 208031 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 10 | 4175562 | 4175741 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 11 | 5695114 | 5695299 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 12 | 2348023 | 2348202 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 13 | 6275615 | 6275800 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 14 | 3815134 | 3815313 | - | NZ_CP009687.1 | Clostridium aceticum |
| 15 | 1642796 | 1642981 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 16 | 567892 | 568071 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 17 | 2593878 | 2594057 | - | NZ_LR134483.1 | Listeria grayi |
| 18 | 281413 | 281598 | - | NZ_CP026363.1 | Brevibacillus agri |
| 19 | 4395107 | 4395292 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 20 | 6150639 | 6150824 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 21 | 1803867 | 1804052 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 22 | 3852710 | 3852895 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 23 | 1122276 | 1122461 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 24 | 6428947 | 6429132 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 25 | 1144602 | 1144787 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 26 | 7129869 | 7130054 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 27 | 7393804 | 7393989 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 28 | 318917 | 319102 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 29 | 4492886 | 4493068 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 30 | 251661 | 251843 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 31 | 6385139 | 6385324 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 32 | 1410258 | 1410443 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 33 | 5013225 | 5013410 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 34 | 155756 | 155938 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 35 | 4127024 | 4127206 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 36 | 4569404 | 4569583 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 37 | 438666 | 438848 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 38 | 6124320 | 6124499 | - | NZ_AP019400.1 | Cohnella abietis |
| 39 | 2983075 | 2983257 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 40 | 565649 | 565828 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 41 | 5128647 | 5128832 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 42 | 155208 | 155390 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 43 | 1032518 | 1032703 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 44 | 721936 | 722127 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 45 | 1308004 | 1308186 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 46 | 2592523 | 2592702 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 47 | 2718408 | 2718587 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 48 | 2697267 | 2697446 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 49 | 387160 | 387339 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 50 | 141985 | 142164 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 51 | 776672 | 776851 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 52 | 129946 | 130134 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 53 | 903572 | 903760 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 54 | 275387 | 275572 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 55 | 730042 | 730221 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 56 | 796735 | 796914 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 57 | 1052258 | 1052437 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 58 | 1662620 | 1662799 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 59 | 145137 | 145325 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 60 | 3786525 | 3786704 | - | NZ_CP011937.1 | Bacillus velezensis |
| 61 | 279862 | 280041 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 62 | 143815 | 143994 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 63 | 144837 | 145016 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 64 | 143576 | 143755 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 65 | 143701 | 143880 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 66 | 113595 | 113774 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 67 | 1865648 | 1865827 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 68 | 143875 | 144054 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 69 | 3615911 | 3616093 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 70 | 150452 | 150634 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 71 | 2065163 | 2065345 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 72 | 2240329 | 2240508 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 73 | 617658 | 617837 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 74 | 1528423 | 1528608 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 75 | 668910 | 669095 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 76 | 338933 | 339115 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 77 | 133381 | 133566 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 78 | 1441967 | 1442152 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 79 | 174465 | 174644 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 80 | 2694997 | 2695176 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 81 | 150190 | 150360 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 82 | 482678 | 482857 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 83 | 149896 | 150066 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 84 | 2602841 | 2603020 | - | NZ_LT906444.1 | Listeria welshimeri |
| 85 | 3433869 | 3434048 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 86 | 1515096 | 1515275 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 87 | 716328 | 716507 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 88 | 754667 | 754846 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 89 | 2163785 | 2163964 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 90 | 2265257 | 2265436 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 91 | 1777259 | 1777438 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 92 | 1635173 | 1635361 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 93 | 1150057 | 1150239 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 94 | 3335970 | 3336152 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 95 | 202123 | 202302 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 96 | 1431078 | 1431257 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 97 | 763037 | 763219 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 98 | 794190 | 794369 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 99 | 1722090 | 1722269 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 100 | 499940 | 500119 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 101 | 147811 | 147993 | + | NZ_CP016538.2 | Planococcus maritimus |
| 102 | 147652 | 147834 | + | NZ_CP059540.1 | Planococcus maritimus |
| 103 | 177307 | 177495 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 104 | 1643399 | 1643584 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 105 | 6739809 | 6739994 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 106 | 1366348 | 1366530 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 107 | 4743980 | 4744162 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 108 | 147183 | 147365 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 109 | 154821 | 155003 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 110 | 1933561 | 1933737 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 111 | 2330339 | 2330527 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 112 | 188182 | 188334 | + | NZ_CP034118.1 | Staphylospora marina |
| 113 | 258444 | 258626 | + | NZ_CP053989.1 | Niallia circulans |
| 114 | 2366538 | 2366714 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 115 | 4683609 | 4683794 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 116 | 1612371 | 1612541 | - | NZ_CP013661.2 | Planococcus kocurii |
| 117 | 580788 | 580967 | + | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 118 | 2309398 | 2309577 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 119 | 150336 | 150506 | + | NZ_CP019401.1 | Planococcus faecalis |
| 120 | 170324 | 170494 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 121 | 4048472 | 4048651 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 122 | 5457518 | 5457697 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 123 | 5290675 | 5290860 | - | NZ_CP009288.1 | Paenibacillus durus |
| 124 | 2614248 | 2614436 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 125 | 154850 | 155020 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 126 | 1763148 | 1763327 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 127 | 3727558 | 3727716 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 128 | 64695 | 64880 | + | NZ_CP036259.1 | Sporomusa termitida |
| 129 | 189046 | 189234 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 130 | 351971 | 352150 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 131 | 1089997 | 1090173 | - | NZ_CP063145.1 | Cruoricaptor ignavus |
| 132 | 8369531 | 8369719 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 133 | 392334 | 392513 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 134 | 1286618 | 1286797 | + | NZ_CP027770.1 | Staphylococcus felis |
| 135 | 3457479 | 3457661 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 136 | 240340 | 240519 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 137 | 1661374 | 1661568 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 138 | 321455 | 321634 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 139 | 149526 | 149678 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 140 | 149576 | 149758 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 141 | 712614 | 712793 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 142 | 2194375 | 2194563 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 143 | 3308526 | 3308708 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 144 | 867785 | 867970 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 145 | 295516 | 295701 | + | NZ_CP030032.1 | Bradymonas sediminis |
| 146 | 138162 | 138332 | + | NZ_CP016540.2 | Planococcus versutus |
| 147 | 5850771 | 5850953 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 148 | 341987 | 342163 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 149 | 1972433 | 1972612 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 150 | 359168 | 359347 | + | NZ_CP019342.1 | Nonlabens tegetincola |
| 151 | 2360532 | 2360717 | + | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 152 | 2121905 | 2122087 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 153 | 90319 | 90501 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 154 | 1710606 | 1710788 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 155 | 1774964 | 1775146 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 156 | 1938123 | 1938305 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 157 | 777276 | 777461 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 158 | 475310 | 475486 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 159 | 4586069 | 4586257 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 160 | 1835135 | 1835317 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 161 | 2944865 | 2945050 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 162 | 55719 | 55904 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 163 | 146225 | 146407 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 164 | 3990865 | 3991050 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 165 | 673400 | 673585 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 166 | 63831 | 64013 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 167 | 147210 | 147365 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 168 | 3090617 | 3090769 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 169 | 6309284 | 6309469 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 170 | 2456334 | 2456501 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 171 | 1747377 | 1747559 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 172 | 2936 | 3118 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 173 | 300101 | 300283 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 174 | 1610282 | 1610464 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 175 | 640640 | 640819 | + | NZ_CP009761.1 | Parvimonas micra |
| 176 | 945011 | 945193 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 177 | 329710 | 329892 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 178 | 485928 | 486110 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 179 | 6059549 | 6059734 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 180 | 1484503 | 1484685 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 181 | 117153 | 117335 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 182 | 1401569 | 1401751 | - | NZ_CP043404.1 | Bacillus safensis |
| 183 | 4039760 | 4039942 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 184 | 145723 | 145905 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 185 | 2420086 | 2420271 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 186 | 4226387 | 4226572 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 187 | 1973321 | 1973500 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 188 | 4838048 | 4838233 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 189 | 139123 | 139305 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 190 | 1853312 | 1853494 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 191 | 1908050 | 1908232 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 192 | 2575324 | 2575506 | + | NZ_CP070062.1 | Coprococcus comes |
| 193 | 1055201 | 1055383 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 194 | 1165111 | 1165293 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 195 | 2749950 | 2750126 | + | NZ_LR134441.1 | Kaistella antarctica |
| 196 | 128127 | 128315 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 197 | 3912234 | 3912416 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 198 | 1484151 | 1484336 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 199 | 1674838 | 1675017 | + | NZ_LR134352.1 | Nocardia asteroides |
| 200 | 84888 | 85067 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 201 | 4219135 | 4219317 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 202 | 2570480 | 2570662 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 203 | 1757710 | 1757892 | + | NZ_CP013237.1 | Streptococcus mutans |
| 204 | 1185555 | 1185734 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 205 | 1426472 | 1426651 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 206 | 1754743 | 1754919 | - | NZ_LR134484.1 | Gemella haemolysans |
| 207 | 677303 | 677485 | + | NZ_CP043405.1 | Streptococcus ratti |
| 208 | 1222990 | 1223166 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 209 | 330969 | 331148 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 210 | 394523 | 394702 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 211 | 2807055 | 2807234 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 212 | 5572386 | 5572565 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 213 | 2535201 | 2535383 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 214 | 7056697 | 7056891 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 215 | 186526 | 186702 | - | NZ_CP046314.1 | Gemella morbillorum |
| 216 | 750939 | 751118 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 217 | 221509 | 221694 | - | NZ_CP034437.1 | Paenibacillus albus |
| 218 | 1445578 | 1445757 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 219 | 134847 | 135029 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 220 | 2795191 | 2795373 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 221 | 1307381 | 1307560 | + | NZ_LS483464.1 | Corynebacterium renale |
| 222 | 52682 | 52834 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 223 | 1994621 | 1994800 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 224 | 3696207 | 3696389 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 225 | 996942 | 997127 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 226 | 2174875 | 2175054 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 227 | 1755743 | 1755895 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 228 | 852944 | 853123 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 229 | 1748359 | 1748541 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 230 | 6407618 | 6407803 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 231 | 1621222 | 1621404 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 232 | 3272629 | 3272817 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 233 | 1504621 | 1504806 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 234 | 444137 | 444319 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 235 | 450750 | 450902 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 236 | 3436774 | 3436962 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 237 | 1755639 | 1755821 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 238 | 2029754 | 2029936 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 239 | 163978 | 164160 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 240 | 94483 | 94665 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 241 | 770110 | 770289 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 242 | 246298 | 246477 | + | NZ_CP047361.1 | Macrococcus canis |
| 243 | 2350162 | 2350338 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 244 | 136506 | 136688 | + | NZ_LS483476.1 | Lederbergia lentus |
| 245 | 1109050 | 1109202 | - | NZ_CP014635.1 | Corynebacterium simulans |
| 246 | 2733883 | 2734062 | - | NZ_CP034549.1 | Nonlabens ponticola |
| 247 | 78836 | 79018 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 248 | 136301 | 136453 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 249 | 2237826 | 2237978 | - | NZ_CP067012.1 | Corynebacterium kefirresidentii |
| 250 | 1824993 | 1825172 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 251 | 509618 | 509773 | + | NZ_CP030280.1 | Blautia argi |
| 252 | 3729188 | 3729367 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 253 | 48713 | 48895 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 254 | 2274503 | 2274673 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 255 | 146889 | 147071 | + | NZ_CP012024.1 | Bacillus smithii |
| 256 | 44229 | 44381 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 257 | 1098884 | 1099063 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 258 | 1990619 | 1990798 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 259 | 3617892 | 3618074 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 260 | 3991120 | 3991302 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 261 | 3070552 | 3070701 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 262 | 2510859 | 2511014 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 263 | 3239868 | 3240050 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 264 | 372653 | 372835 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 265 | 1195767 | 1195949 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 266 | 1244016 | 1244201 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 267 | 852021 | 852203 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 268 | 642794 | 642976 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 269 | 136607 | 136789 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 270 | 1157126 | 1157308 | + | NZ_CP018044.1 | Bifidobacterium choerinum |
| 271 | 2952333 | 2952521 | + | NZ_AP022562.1 | Mycobacterium novum |
| 272 | 3530641 | 3530829 | - | NC_015576.1 | Mycolicibacter sinensis |
| 273 | 553456 | 553635 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 274 | 1138818 | 1138997 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 275 | 2432176 | 2432358 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 276 | 2258615 | 2258794 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 277 | 1404956 | 1405126 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 278 | 5523691 | 5523870 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 279 | 73270 | 73452 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 280 | 626051 | 626227 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 281 | 1204434 | 1204613 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 282 | 100138 | 100320 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 283 | 4362283 | 4362465 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 284 | 644800 | 644979 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 285 | 498138 | 498320 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 286 | 2583965 | 2584147 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 287 | 1987262 | 1987441 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 288 | 699242 | 699424 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 289 | 3976474 | 3976653 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 290 | 5085641 | 5085796 | - | NZ_CP039126.1 | Blautia producta |
| 291 | 617414 | 617605 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 292 | 610577 | 610768 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 293 | 644180 | 644359 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 294 | 504687 | 504839 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 295 | 2686410 | 2686592 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 296 | 2362741 | 2362929 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 297 | 3531008 | 3531187 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 298 | 1696652 | 1696831 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 299 | 3249445 | 3249624 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 300 | 2117303 | 2117482 | - | NZ_CP017267.1 | Vagococcus teuberi |
| 301 | 2015636 | 2015824 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 302 | 312512 | 312691 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 303 | 456592 | 456768 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 304 | 1466461 | 1466616 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 305 | 2814396 | 2814575 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 306 | 1837807 | 1837983 | - | NZ_CP034159.1 | Kaistella carnis |
| 307 | 766462 | 766647 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 308 | 4176086 | 4176265 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 309 | 4984506 | 4984688 | - | NZ_CP040336.1 | Bacillus luti |
| 310 | 134926 | 135108 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 311 | 2055351 | 2055530 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 312 | 248296 | 248448 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 313 | 2544095 | 2544274 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 314 | 2484749 | 2484928 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 315 | 2072200 | 2072388 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 316 | 138571 | 138753 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 317 | 1327911 | 1328084 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 318 | 129483 | 129665 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 319 | 135128 | 135310 | + | NC_011725.1 | Bacillus cereus B4264 |
| 320 | 2573992 | 2574174 | - | NZ_CP015961.1 | Dietzia timorensis |
| 321 | 171418 | 171600 | - | NZ_CP028811.1 | Flavobacterium magnum |
| 322 | 135792 | 135974 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 323 | 81649 | 81831 | + | NC_012924.1 | Streptococcus suis SC84 |
| 324 | 590283 | 590462 | - | NC_020156.1 | Nonlabens dokdonensis DSW-6 |
| 325 | 1141067 | 1141246 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 326 | 2986718 | 2986900 | - | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 327 | 2605546 | 2605728 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 328 | 2525576 | 2525758 | - | NZ_CP015449.1 | Dietzia lutea |
| 329 | 165037 | 165225 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 330 | 1201857 | 1202027 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 331 | 2131718 | 2131897 | - | NZ_CP029256.1 | Christensenella minuta |
| 332 | 570167 | 570349 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 333 | 1054862 | 1055041 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 334 | 1215389 | 1215574 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 335 | 2581613 | 2581795 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 336 | 398181 | 398366 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 337 | 152311 | 152496 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 338 | 425714 | 425890 | - | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 339 | 2829869 | 2830021 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 340 | 2259992 | 2260144 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 341 | 340783 | 340938 | + | NZ_LN879430.1 | Herbinix luporum |
| 342 | 3181067 | 3181243 | + | NZ_CP022986.1 | Chryseobacterium camelliae |
| 343 | 1795577 | 1795759 | + | NZ_CP021434.1 | Tumebacillus avium |
| 344 | 70590 | 70769 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 345 | 2926458 | 2926640 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 346 | 2373058 | 2373237 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 347 | 4764792 | 4764998 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 348 | 2890540 | 2890722 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 349 | 136217 | 136369 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 350 | 162931 | 163113 | - | NZ_CP029187.1 | Flavobacterium pallidum |
| 351 | 136966 | 137118 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 352 | 3985377 | 3985565 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 353 | 261196 | 261375 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 354 | 510500 | 510679 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 355 | 2738410 | 2738586 | - | NZ_CP050995.1 | Chryseobacterium gallinarum |
| 356 | 4025194 | 4025370 | - | NZ_CP033914.1 | Chryseobacterium shandongense |
| 357 | 2426065 | 2426244 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 358 | 2069192 | 2069371 | - | NZ_LT906473.1 | Corynebacterium cystitidis |
| 359 | 3403692 | 3403871 | + | NZ_CP037933.1 | Flavobacterium nackdongense |
| 360 | 581987 | 582166 | - | NZ_CP023011.2 | Enterococcus hirae |
| 361 | 440850 | 441026 | + | NZ_CP023863.1 | Prevotella jejuni |
| 362 | 74995 | 75174 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 363 | 77697 | 77876 | + | NZ_CP065211.1 | Enterococcus lactis |
| 364 | 2690845 | 2691027 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 365 | 217562 | 217741 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 366 | 2344877 | 2345059 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 367 | 1163450 | 1163632 | + | NZ_AP018712.1 | Tepiditoga spiralis |
| 368 | 7656380 | 7656562 | - | NC_014666.1 | Frankia inefficax |
| 369 | 2502184 | 2502369 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 370 | 3512060 | 3512242 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 371 | 501209 | 501394 | + | NZ_LT906467.1 | Corynebacterium imitans |
| 372 | 1876782 | 1876946 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 373 | 323342 | 323509 | + | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 374 | 240417 | 240596 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 375 | 2527786 | 2527962 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 376 | 243739 | 243918 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 377 | 402476 | 402628 | + | NZ_CP019688.1 | Corynebacterium glaucum |
| 378 | 2352227 | 2352385 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 379 | 5051157 | 5051336 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 380 | 2195478 | 2195657 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 381 | 4694783 | 4694962 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 382 | 826548 | 826730 | - | NZ_CP017774.1 | Flavobacterium commune |
| 383 | 399071 | 399253 | - | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 384 | 244162 | 244341 | + | NC_008593.1 | Clostridium novyi NT |
| 385 | 4056304 | 4056459 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 386 | 4041821 | 4042000 | - | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 387 | 2012276 | 2012449 | - | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 388 | 4068289 | 4068468 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 389 | 191633 | 191815 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 390 | 2873024 | 2873203 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 391 | 4679732 | 4679926 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 392 | 1839524 | 1839700 | + | NZ_CP033924.1 | Chryseobacterium lactis |
| 393 | 2419603 | 2419782 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 394 | 3165955 | 3166134 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 395 | 1295090 | 1295248 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 396 | 2434742 | 2434924 | + | NZ_CP016907.1 | Flavobacterium anhuiense |
| 397 | 2353546 | 2353728 | + | NZ_CP043612.1 | Flavobacterium nitrogenifigens |
| 398 | 406606 | 406788 | - | NZ_CP029255.1 | Flavobacterium crocinum |
| 399 | 2514867 | 2515058 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 400 | 2393500 | 2393685 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 401 | 1182854 | 1183036 | + | NZ_CP017688.1 | Flavobacterium crassostreae |
| 402 | 4493631 | 4493810 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 403 | 1878827 | 1879003 | - | NZ_LR215974.1 | Chryseobacterium taihuense |
| 404 | 751913 | 752089 | + | NZ_CP033929.1 | Chryseobacterium indoltheticum |
| 405 | 2745147 | 2745323 | - | NZ_CP023049.2 | Chryseobacterium piperi |
| 406 | 1510824 | 1511000 | - | NZ_CP015199.1 | Chryseobacterium glaciei |
| 407 | 810931 | 811107 | - | NZ_CP033920.1 | Chryseobacterium carnipullorum |
| 408 | 471010 | 471177 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 409 | 2719431 | 2719613 | - | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 410 | 2069985 | 2070164 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 411 | 4437215 | 4437394 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 412 | 385562 | 385747 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 413 | 2278968 | 2279153 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 414 | 222155 | 222334 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 415 | 511419 | 511598 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 416 | 450676 | 450852 | + | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 417 | 1730030 | 1730212 | + | NZ_CP020918.1 | Flavobacterium faecale |
| 418 | 115255 | 115434 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 419 | 1548041 | 1548229 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 420 | 188691 | 188873 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 421 | 297739 | 297921 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 422 | 1123375 | 1123554 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 423 | 1848705 | 1848884 | - | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 424 | 1007319 | 1007495 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 425 | 2252277 | 2252462 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 426 | 2216852 | 2217031 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 427 | 352576 | 352764 | - | NZ_LS974202.1 | Mesotoga infera |
| 428 | 3684434 | 3684610 | + | NZ_CP033926.1 | Chryseobacterium joostei |
| 429 | 703930 | 704106 | + | NZ_LR134386.1 | Chryseobacterium nakagawai |
| 430 | 3928822 | 3929001 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 431 | 1819136 | 1819312 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 432 | 2653760 | 2653939 | - | NZ_HG917868.1 | Clostridium bornimense |
| 433 | 6081776 | 6081946 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 434 | 2102590 | 2102745 | - | NZ_CP059567.1 | Neisseria shayeganii |
| 435 | 4459959 | 4460138 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 436 | 1703925 | 1704101 | + | NZ_CP033932.1 | Chryseobacterium bernardetii |
| 437 | 4048465 | 4048641 | + | NZ_LR134289.1 | Chryseobacterium gleum |
| 438 | 1216789 | 1216971 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 439 | 749933 | 750115 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 440 | 1282296 | 1282475 | - | NZ_CP019914.1 | Brachyspira hampsonii |
| 441 | 1921330 | 1921515 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
| 442 | 2252796 | 2252975 | + | NZ_CP046932.1 | Brachyspira hyodysenteriae |
| 443 | 2826753 | 2826929 | - | NZ_LR134384.1 | Prevotella oris |
| 444 | 1717811 | 1717987 | - | NZ_LR134503.1 | Kaistella jeonii |
| 445 | 2868883 | 2869062 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 446 | 43940 | 44089 | + | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 447 | 1105192 | 1105347 | + | NZ_CP031699.1 | Neisseria animalis |
| 448 | 2893968 | 2894129 | - | NZ_AP018437.1 | Pelolinea submarina |
| 449 | 4125534 | 4125704 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 450 | 447640 | 447825 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 451 | 1980258 | 1980437 | + | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 452 | 730703 | 730867 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 453 | 1350320 | 1350502 | + | NZ_CP038810.1 | Flavobacterium sangjuense |
| 454 | 789558 | 789734 | + | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
| 455 | 159850 | 160029 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 456 | 5281008 | 5281187 | - | NZ_CP020953.1 | Clostridium drakei |
| 457 | 4643014 | 4643193 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 458 | 3259100 | 3259276 | - | NZ_CP034161.1 | Epilithonimonas vandammei |
| 459 | 3276868 | 3277050 | + | NZ_CP017478.1 | Urechidicola croceus |
| 460 | 1137946 | 1138122 | - | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 461 | 471363 | 471545 | + | NZ_CP022544.1 | Bifidobacterium pseudolongum |
| 462 | 387191 | 387361 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 463 | 4430638 | 4430817 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 464 | 3317516 | 3317674 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 465 | 3227228 | 3227410 | + | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 466 | 2611192 | 2611362 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 467 | 2108950 | 2109129 | + | NC_014150.1 | Brachyspira murdochii DSM 12563 |
| 468 | 443906 | 444070 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 469 | 32989 | 33171 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 470 | 864379 | 864558 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 471 | 453741 | 453899 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 472 | 974198 | 974350 | + | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 473 | 3536283 | 3536465 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 474 | 3450797 | 3450979 | + | NC_016599.1 | Owenweeksia hongkongensis DSM 17368 |
| 475 | 370429 | 370587 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 476 | 1203984 | 1204145 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 477 | 491188 | 491370 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 478 | 1455247 | 1455426 | + | NZ_CP015125.1 | Dokdonia donghaensis DSW-1 |
| 479 | 1300546 | 1300728 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 480 | 2693228 | 2693410 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 481 | 2737687 | 2737869 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 482 | 140281 | 140469 | + | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 483 | 448383 | 448559 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 484 | 2451235 | 2451414 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 485 | 2954817 | 2954978 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 486 | 253554 | 253742 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 487 | 2768380 | 2768568 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 488 | 2269585 | 2269764 | - | NZ_CP019288.1 | Kordia antarctica |
| 489 | 481339 | 481518 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 490 | 3143837 | 3144007 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 491 | 412078 | 412260 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 492 | 1561304 | 1561486 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 493 | 1125678 | 1125851 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 494 | 462176 | 462340 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 495 | 278932 | 279111 | + | NC_022549.1 | Acholeplasma brassicae |
| 496 | 1470291 | 1470473 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 497 | 621863 | 622015 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 498 | 2064749 | 2064928 | + | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 499 | 669283 | 669465 | + | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 500 | 36006 | 36155 | + | NZ_AP014568.1 | Serpentinomonas raichei |
| 501 | 4162564 | 4162746 | - | NC_014041.1 | Zunongwangia profunda SM-A87 |
| 502 | 2218548 | 2218700 | + | NZ_CP020046.1 | Thiomonas intermedia |
| 503 | 2941738 | 2941917 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 504 | 616173 | 616373 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 505 | 3350366 | 3350524 | - | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 506 | 1717409 | 1717603 | + | NZ_CP014228.1 | Actinomyces radicidentis |
| 507 | 4493951 | 4494130 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 508 | 1319276 | 1319443 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 509 | 437569 | 437754 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 510 | 274887 | 275066 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 511 | 704832 | 705011 | - | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 512 | 259841 | 260020 | + | NZ_CP016786.1 | Clostridium isatidis |
| 513 | 2789681 | 2789836 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 514 | 3262890 | 3263063 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 515 | 4164428 | 4164610 | + | NZ_CP025791.1 | Flavivirga eckloniae |
| 516 | 903175 | 903354 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 517 | 92593 | 92766 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 518 | 1289911 | 1290096 | - | NC_013203.1 | Lancefieldella parvulum DSM 20469 |
| 519 | 1148201 | 1148368 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 520 | 2670020 | 2670187 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 521 | 1539557 | 1539733 | - | NZ_AP018042.1 | Labilibaculum antarcticum |
| 522 | 180161 | 180346 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 523 | 2986377 | 2986553 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 524 | 114748 | 114933 | + | NZ_LT635455.1 | Olsenella timonensis |
| 525 | 2049166 | 2049348 | + | NZ_CP039934.1 | Myroides fluvii |
| 526 | 2249490 | 2249675 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 527 | 361380 | 361565 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 528 | 246478 | 246663 | + | NZ_AP019367.1 | Parolsenella catena |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019870.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00406.24 | 0.69 | 365 | 1826.0 | same-strand | Adenylate kinase |
| 2 | PF13207.8 | 0.69 | 365 | 1826.0 | same-strand | AAA domain |
| 3 | PF00344.22 | 0.9 | 476 | 474 | same-strand | SecY |
| 4 | PF00828.21 | 0.99 | 523 | 23.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 5 | PF00333.22 | 1.0 | 526 | 14 | same-strand | Ribosomal protein S5, N-terminal domain |
| 6 | PF03719.17 | 1.0 | 525 | 14.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 7 | PF00861.24 | 0.99 | 522 | 539 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 8 | PF00347.25 | 1.0 | 527 | 934.0 | same-strand | Ribosomal protein L6 |
| 9 | PF00410.21 | 1.0 | 527 | 1507.0 | same-strand | Ribosomal protein S8 |
| 10 | PF00253.23 | 0.85 | 446 | 1940 | same-strand | Ribosomal protein S14p/S29e |
++ More..