Result : Q18B11
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | AM180355.1 |
| Organism | Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Left | 1350200 |
| Right | 1350484 |
| Strand | + |
| Nucleotide Sequence | GTGTTAGATTTATTTAGAGTTTTTTCTAACGAGGCTAAAACTAGTAAATCTGTTGCTAAAGAGAGGTTAAAGCTAGTTTTAGTTCATGATAGAGTAGATTGTTCACCACAACTTTTAGAGATGATAAAAACAGACATTTTAAAAGTAATAGCTAATTATGCAGAAATAGAAGATGATGGTCTTGAAATAAAAATGTCTAAATGCAGAGGTGAGCATGATGACAAACCTGTATCTGCATTAGTTGCTAATATACCACTAAAGAATATAAAAGATAGATGTATGTAA |
| Sequence | MLDLFRVFSNEAKTSKSVAKERLKLVLVHDRVDCSPQLLEMIKTDILKVIANYAEIEDDGLEIKMSKCRGEHDDKPVSALVANIPLKNIKDRCM |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 16804543 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q18B11 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2807415 | 2807699 | - | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 573986 | 574270 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 3 | 2031924 | 2032205 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 4 | 1859305 | 1859586 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 5 | 2365141 | 2365425 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 6 | 1155388 | 1155672 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 7 | 1410011 | 1410292 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 8 | 1714081 | 1714368 | + | NZ_CP009687.1 | Clostridium aceticum |
| 9 | 1860876 | 1861163 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 10 | 5606512 | 5606787 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 11 | 2087142 | 2087426 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 12 | 1312676 | 1312957 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 13 | 780838 | 781119 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 14 | 1210165 | 1210449 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 15 | 3505256 | 3505540 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 16 | 370832 | 371113 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 17 | 108278 | 108562 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 18 | 1546473 | 1546745 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 19 | 913154 | 913429 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 20 | 2514256 | 2514525 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 21 | 1621315 | 1621590 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 22 | 1157853 | 1158128 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 23 | 2990627 | 2990893 | - | NZ_CP014176.1 | Clostridium argentinense |
| 24 | 3166971 | 3167240 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 25 | 1155975 | 1156250 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 26 | 5386401 | 5386670 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 27 | 4493020 | 4493289 | - | NZ_CP020953.1 | Clostridium drakei |
| 28 | 3373066 | 3373332 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 29 | 1474381 | 1474656 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 30 | 2766608 | 2766874 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 31 | 3632813 | 3633082 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 32 | 3795239 | 3795517 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 33 | 1026198 | 1026473 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 34 | 2358233 | 2358499 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 35 | 2360309 | 2360569 | - | NZ_CP016786.1 | Clostridium isatidis |
| 36 | 755032 | 755334 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 37 | 1348892 | 1349194 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 38 | 2704106 | 2704372 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 39 | 1056151 | 1056426 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 40 | 487025 | 487321 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 41 | 1450757 | 1450996 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 42 | 2015793 | 2016095 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 43 | 1566907 | 1567209 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 44 | 1397545 | 1397847 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 45 | 1184441 | 1184686 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 46 | 1370161 | 1370400 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 47 | 1423535 | 1423837 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 48 | 2422676 | 2422948 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 49 | 1731643 | 1731921 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 50 | 2644185 | 2644451 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 51 | 3085512 | 3085796 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 52 | 1090783 | 1091013 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 53 | 610431 | 610688 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 54 | 66715 | 66999 | - | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019870.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02142.24 | 0.61 | 33 | 1140 | same-strand | MGS-like domain |
| 2 | PF01098.21 | 0.72 | 39 | 91 | same-strand | Cell cycle protein |
| 3 | PF13614.8 | 0.98 | 53 | 18 | same-strand | AAA domain |
| 4 | PF01656.25 | 1.0 | 54 | 17.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF10609.11 | 0.98 | 53 | 18 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 6 | PF03775.18 | 1.0 | 54 | 843.5 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 7 | PF03717.17 | 0.87 | 47 | 1621.0 | same-strand | Penicillin-binding Protein dimerisation domain |
| 8 | PF00905.24 | 0.85 | 46 | 1609.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 9 | PF04093.14 | 0.67 | 36 | 4366.5 | same-strand | rod shape-determining protein MreD |
| 10 | PF04085.16 | 0.8 | 43 | 4463 | same-strand | rod shape-determining protein MreC |
++ More..