Result : Q18AS6

Protein Information

• Protein name: UPF0291 protein CD630_10710
• NCBI Accession ID: AM180355.1
• Organism: Clostridioides difficile (strain 630) (Peptoclostridium difficile)
• Left: 1265333
• Right: 1265542
• Strand: +
• Nucleotide Sequence: ATGTTTGACAAGAAGAAATTAGATAGGATTAATGAATTAGCAAAGAAAAATAAAGAGGGAATCCTTTCTGCTGATGAAATCAAAGAAAGAGAAATTTTAAGGAAAGAATATTTAGAAAACTTTAGAGCCCACTTTAGATCAAGACTAGATAGTGTCAAAGTAGTTTCACCAGAAGAATATGAGCAATACATGAAAAACAATAAAAATTAG
• Sequence: MFDKKKLDRINELAKKNKEGILSADEIKEREILRKEYLENFRAHFRSRLDSVKVVSPEEYEQYMKNNKN
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional
• Pubmed ID: 16804543
• Domain: CDD:413030
• Functional Category: Others
• Uniprot ID: Q18AS6
• ORF Length (Amino Acid): 69

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2861806	2862015	-	NZ_CP019870.1	Clostridioides difficile
2	543211	543429	+	NZ_CP014150.1	Paeniclostridium sordellii

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP019870.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00392.23	1.0	2	29	same-strand	Bacterial regulatory proteins, gntR family
2	PF02127.17	1.0	2	49.0	same-strand	Aminopeptidase I zinc metalloprotease (M18)
3	PF00155.23	1.0	2	21.5	same-strand	Aminotransferase class I and II
4	PF02811.21	1.0	2	1567.5	opposite-strand	PHP domain
5	PF01943.19	1.0	2	2437.5	opposite-strand	Polysaccharide biosynthesis protein
6	PF01554.20	1.0	2	2437.5	opposite-strand	MatE