Result : Q182S6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AM180355.1 |
| Organism | Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Left | 2993904 |
| Right | 2994170 |
| Strand | - |
| Nucleotide Sequence | ATGTTAAAACCATCTATCAATGAGGTACTAGAAAAAATAGACAACAGATACTATTTAGTAGGGACTGTTTCAAAGAGAGCAAGAAAATTAATTGATGGAGAAGAACCATATGTTTCAAATAAAACTAAGGAAAAGCCTGTATGTGTAGCAACTAAAGAAGTTGCAAGTGGAAAAATAACATATAGATTATTGACAGAAGAGGAAATAGAGATAGAAGAAGCTAGACATCATGCTGAGCAACACCAACAAATTTCAGAAGAGGAGTAA |
| Sequence | MLKPSINEVLEKIDNRYYLVGTVSKRARKLIDGEEPYVSNKTKEKPVCVATKEVASGKITYRLLTEEEIEIEEARHHAEQHQQISEEE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 16804543 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q182S6 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1172825 | 1173091 | + | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 914223 | 914492 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 3 | 2976705 | 2976974 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019870.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05833.13 | 0.67 | 2 | 3390.0 | opposite-strand | NFACT N-terminal and middle domains |
| 2 | PF05670.15 | 0.67 | 2 | 3390.0 | opposite-strand | NFACT protein RNA binding domain |
| 3 | PF01212.23 | 0.67 | 2 | 3052.5 | same-strand | Beta-eliminating lyase |
| 4 | PF01678.21 | 1.0 | 3 | 1555 | same-strand | Diaminopimelate epimerase |
| 5 | PF03755.15 | 1.0 | 3 | 669 | same-strand | YicC-like family, N-terminal region |
| 6 | PF08340.13 | 1.0 | 3 | 669 | same-strand | Domain of unknown function (DUF1732) |
| 7 | PF00625.23 | 1.0 | 3 | 2 | same-strand | Guanylate kinase |
| 8 | PF13238.8 | 1.0 | 3 | 2 | same-strand | AAA domain |
| 9 | PF04127.17 | 1.0 | 3 | 5 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 10 | PF02441.21 | 1.0 | 3 | 5 | same-strand | Flavoprotein |
| 11 | PF17764.3 | 1.0 | 3 | 1338 | same-strand | 3'DNA-binding domain (3'BD) |
| 12 | PF04851.17 | 1.0 | 3 | 1338 | same-strand | Type III restriction enzyme, res subunit |
| 13 | PF18074.3 | 1.0 | 3 | 1338 | same-strand | Primosomal protein N C-terminal domain |
| 14 | PF00270.31 | 1.0 | 3 | 1338 | same-strand | DEAD/DEAH box helicase |
| 15 | PF18319.3 | 1.0 | 3 | 1338 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 16 | PF01327.23 | 1.0 | 3 | 3840 | same-strand | Polypeptide deformylase |
| 17 | PF00551.21 | 1.0 | 3 | 4326 | same-strand | Formyl transferase |
| 18 | PF02911.20 | 1.0 | 3 | 4326 | same-strand | Formyl transferase, C-terminal domain |
| 19 | PF01976.19 | 1.0 | 3 | 5264 | same-strand | Protein of unknown function DUF116 |
++ More..