| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | AM180355.1 |
| Organism | Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Left | 4274033 |
| Right | 4274311 |
| Strand | - |
| Nucleotide Sequence | GTGAGAAATTATGAATTAGTTTATGTGGTAAAGCCAAACTCTGATGAAGAAGTAAGAGAGGCTATACTAAACAAAGTTAAGGAAGTTGTTGCAACTGACGGAGAAATAGTTAAAGTTGATACTTGGGGAACTAAAAAATTAGCTTATCCAATAGCTAAGTTTACAGAAGGTTTCTATGTATTAGTTAACTTCAAATCAGCAGTAGACGTTCCTAAAGAGATAGACAGAAACTTAAAGATAAATGAAAACGTAATAAGACACATGATAGTTGTTGCTTAA |
| Sequence | MRNYELVYVVKPNSDEEVREAILNKVKEVVATDGEIVKVDTWGTKKLAYPIAKFTEGFYVLVNFKSAVDVPKEIDRNLKINENVIRHMIVVA |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 16804543 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q181R5 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4079070 | 4079348 | + | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 3533886 | 3534164 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 3 | 162512 | 162796 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 4 | 2700035 | 2700322 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 5 | 2231990 | 2232283 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 6 | 1881283 | 1881570 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 7 | 2911607 | 2911894 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 8 | 34122 | 34406 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 9 | 43948 | 44232 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 10 | 39789 | 40073 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 11 | 30652 | 30936 | + | NZ_CP009687.1 | Clostridium aceticum |
| 12 | 2724951 | 2725238 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 13 | 193478 | 193765 | + | NZ_CP014176.1 | Clostridium argentinense |
| 14 | 383294 | 383578 | + | NZ_AP022321.1 | Veillonella nakazawae |
| 15 | 359505 | 359789 | + | NZ_LR134375.1 | Veillonella dispar |
| 16 | 422679 | 422963 | + | NZ_LR778174.1 | Veillonella parvula |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00436.27 | 1.0 | 16 | 25.0 | same-strand | Single-strand binding protein family |
| 2 | PF01084.22 | 1.0 | 16 | 476.5 | same-strand | Ribosomal protein S18 |