Result : Q16B38
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Coenzyme PQQ synthesis protein A (Pyrroloquinoline quinone biosynthesis protein A) |
| NCBI Accession ID | CP000362.1 |
| Organism | Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) |
| Left | 1115371 |
| Right | 1115478 |
| Strand | - |
| Nucleotide Sequence | ATGGCTTGGACGAAACCAATCATCCGCGAAATCGAGTGCGGCATGGAAATCAACATGTACGGACCAGAGAACGAAGATCGTCACGACGACCGCGACGACCTGTTCTAA |
| Sequence | MAWTKPIIREIECGMEINMYGPENEDRHDDRDDLF |
| Source of smORF | Swiss-Prot |
| Function | Required for coenzyme pyrroloquinoline quinone (PQQ) biosynthesis. PQQ is probably formed by cross-linking a specific glutamate to a specific tyrosine residue and excising these residues from the peptide. {ECO:0000255|HAMAP-Rule:MF_00656}. |
| Pubmed ID | 17098896 |
| Domain | CDD:391614 |
| Functional Category | Others |
| Uniprot ID | Q16B38 |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3732998 | 3733105 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 2 | 3271579 | 3271686 | - | NZ_CP027407.1 | Roseobacter denitrificans |
| 3 | 438538 | 438636 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 4 | 1335555 | 1335656 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 5 | 187489 | 187596 | + | NZ_CP021048.1 | Phaeobacter gallaeciensis |
| 6 | 243419 | 243526 | + | NZ_CP032125.1 | Profundibacter amoris |
| 7 | 3391746 | 3391850 | + | NZ_CP048788.1 | Roseobacter ponti |
| 8 | 3797290 | 3797397 | + | NZ_CP041159.1 | Leisingera aquaemixtae |
| 9 | 2577260 | 2577355 | - | NZ_CP040818.1 | Paraoceanicella profunda |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015730.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12706.9 | 1.0 | 9 | 31 | same-strand | Beta-lactamase superfamily domain |
| 2 | PF03070.18 | 1.0 | 9 | 920 | same-strand | TENA/THI-4/PQQC family |
| 3 | PF05402.14 | 1.0 | 9 | 1671 | same-strand | Coenzyme PQQ synthesis protein D (PqqD) |
| 4 | PF04055.23 | 1.0 | 9 | 1943 | same-strand | Radical SAM superfamily |
| 5 | PF13186.8 | 1.0 | 9 | 1943 | same-strand | Iron-sulfur cluster-binding domain |
++ More..