Result : Q15ZP6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SlyX homolog |
| NCBI Accession ID | CP000388.1 |
| Organism | Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) |
| Left | 125825 |
| Right | 126037 |
| Strand | + |
| Nucleotide Sequence | ATGCAACACATAGAAGCAGATATAGAGCAGCTACAAATGAAGGTGGCTTTTCAAGAGGACACCATAGAAGAACTAAACAAAGCCTTGATCAAGCAACAGAAGCAACTCGAACTGTTAGAGTTTCAGTTGTCTCATGTCATTAACAAGGTCAAAGAAATTGATGTGCCCAGCGGCGATTCACAAGAAGTTGAACCGCCACCGCCGCATTACTAG |
| Sequence | MQHIEADIEQLQMKVAFQEDTIEELNKALIKQQKQLELLEFQLSHVINKVKEIDVPSGDSQEVEPPPPHY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412736 |
| Functional Category | Others |
| Uniprot ID | Q15ZP6 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 95521 | 95691 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
| 2 | 4359954 | 4360130 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 3 | 3585436 | 3585615 | - | NZ_LS483250.1 | Moritella yayanosii |
| 4 | 4200024 | 4200194 | - | NZ_CP008849.1 | Alteromonas australica |
| 5 | 371193 | 371369 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 6 | 4027282 | 4027494 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 7 | 2336046 | 2336270 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 8 | 114877 | 115047 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 9 | 507322 | 507492 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 10 | 1936394 | 1936576 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 11 | 441655 | 441825 | - | NZ_LR134167.1 | Avibacterium volantium |
| 12 | 1910705 | 1910887 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029347.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00254.30 | 1.0 | 12 | 721.0 | opposite-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 2 | PF01346.20 | 1.0 | 12 | 721.0 | opposite-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 3 | PF00005.29 | 0.67 | 8 | 2497.0 | same-strand | ABC transporter |
++ More..