Protein Information |
Information Type | Description |
---|---|
Protein name | Protein SlyX homolog |
NCBI Accession ID | CP000388.1 |
Organism | Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) |
Left | 125825 |
Right | 126037 |
Strand | + |
Nucleotide Sequence | ATGCAACACATAGAAGCAGATATAGAGCAGCTACAAATGAAGGTGGCTTTTCAAGAGGACACCATAGAAGAACTAAACAAAGCCTTGATCAAGCAACAGAAGCAACTCGAACTGTTAGAGTTTCAGTTGTCTCATGTCATTAACAAGGTCAAAGAAATTGATGTGCCCAGCGGCGATTCACAAGAAGTTGAACCGCCACCGCCGCATTACTAG |
Sequence | MQHIEADIEQLQMKVAFQEDTIEELNKALIKQQKQLELLEFQLSHVINKVKEIDVPSGDSQEVEPPPPHY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
Pubmed ID | |
Domain | CDD:412736 |
Functional Category | Others |
Uniprot ID | Q15ZP6 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 95521 | 95691 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
2 | 4359954 | 4360130 | - | NZ_CP046670.1 | Alteromonas mediterranea |
3 | 3585436 | 3585615 | - | NZ_LS483250.1 | Moritella yayanosii |
4 | 4200024 | 4200194 | - | NZ_CP008849.1 | Alteromonas australica |
5 | 371193 | 371369 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
6 | 4027282 | 4027494 | - | NZ_CP036536.1 | Salinimonas lutimaris |
7 | 2336046 | 2336270 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
8 | 114877 | 115047 | + | NZ_CP031769.1 | Salinimonas sediminis |
9 | 507322 | 507492 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
10 | 1936394 | 1936576 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
11 | 441655 | 441825 | - | NZ_LR134167.1 | Avibacterium volantium |
12 | 1910705 | 1910887 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00254.30 | 1.0 | 12 | 721.0 | opposite-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
2 | PF01346.20 | 1.0 | 12 | 721.0 | opposite-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
3 | PF00005.29 | 0.67 | 8 | 2497.0 | same-strand | ABC transporter |