Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0352 protein Patl_3379 |
NCBI Accession ID | CP000388.1 |
Organism | Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) |
Left | 4053374 |
Right | 4053592 |
Strand | + |
Nucleotide Sequence | ATGCCTCAAAATTCTAAATATTCGGACACCCAATTCGAAAACGTTATGCACGACATCATCATCGCACTGGAAAAGCATCAAGCCAGTCGAGATTTATCATTGATGGCGTTGGGTAATGTCATCACTAATATTTTTATGCAACAGGTCAATGAAAGTCAGCGAAGTGAAATGGCTGATAAGTTTACACAAGTACTTTTAAAAAGTATCAATGCTAAATAG |
Sequence | MPQNSKYSDTQFENVMHDIIIALEKHQASRDLSLMALGNVITNIFMQQVNESQRSEMADKFTQVLLKSINAK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01175. Profile Description: Protein of unknown function (DUF1414). hypothetical protein; Provisional |
Pubmed ID | |
Domain | CDD:412779 |
Functional Category | Others |
Uniprot ID | Q15QF3 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1690017 | 1690256 | + | NZ_CP029347.1 | Saliniradius amylolyticus |
2 | 2160263 | 2160481 | - | NZ_CP008849.1 | Alteromonas australica |
3 | 2180808 | 2181023 | + | NZ_CP036536.1 | Salinimonas lutimaris |
4 | 1755424 | 1755639 | - | NC_015554.1 | Alteromonas naphthalenivorans |
5 | 2461513 | 2461728 | + | NZ_CP014322.1 | Alteromonas addita |
6 | 2060188 | 2060403 | - | NZ_CP031769.1 | Salinimonas sediminis |
7 | 1965927 | 1966151 | + | NZ_AP019657.1 | Vibrio ponticus |
8 | 4160158 | 4160373 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
9 | 2189185 | 2189403 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
10 | 2160834 | 2161058 | + | NZ_CP047475.1 | Vibrio astriarenae |
11 | 2091131 | 2091349 | - | NZ_CP046670.1 | Alteromonas mediterranea |
12 | 1059453 | 1059668 | - | NZ_AP018685.1 | Vibrio rumoiensis |
13 | 1959539 | 1959757 | + | NZ_CP040021.1 | Salinivibrio kushneri |
14 | 1591312 | 1591527 | + | NZ_AP018689.1 | Vibrio aphrogenes |
15 | 1318952 | 1319167 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07238.16 | 0.6 | 9 | 5103 | opposite-strand | PilZ domain |
2 | PF12945.9 | 0.6 | 9 | 5103 | opposite-strand | Flagellar protein YcgR |
3 | PF17899.3 | 0.6 | 9 | 3193 | same-strand | Peptidase M61 N-terminal domain |
4 | PF05299.14 | 0.6 | 9 | 3193 | same-strand | M61 glycyl aminopeptidase |
5 | PF13180.8 | 0.6 | 9 | 3193 | same-strand | PDZ domain |
6 | PF04245.15 | 0.93 | 14 | 160.0 | opposite-strand | 37-kD nucleoid-associated bacterial protein |
7 | PF11893.10 | 1.0 | 15 | 13 | same-strand | Domain of unknown function (DUF3413) |