Result : Q14JB2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AM286280.1 |
| Organism | Francisella tularensis subsp. tularensis (strain FSC 198) |
| Left | 341834 |
| Right | 342034 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAGAAAAGATACTTTAAAAGATTATAGAGGTAAAAGTATTGACCAATTGCAAGAAGCGAAAATAGAGTTATTGCAACAGTTATTTTCTCTTCGCATGCAGAAGGGTACAGGGCAATTAAAGAAAAATCACTTGTTCAAAAGTGCTAAAAGGGATATTGCTCGTATTAATACAATAATATCAGAAAAGAATAAATAG |
| Sequence | MKRKDTLKDYRGKSIDQLQEAKIELLQQLFSLRMQKGTGQLKKNHLFKSAKRDIARINTIISEKNK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 17406676 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q14JB2 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 235871 | 236071 | + | NC_017449.1 | Francisella hispaniensis |
| 2 | 241599 | 241799 | + | NC_015696.1 | Francisella salina |
| 3 | 1552208 | 1552408 | - | NZ_CP043552.1 | Francisella marina |
| 4 | 233705 | 233905 | + | NZ_CP022375.1 | Francisella opportunistica |
| 5 | 426305 | 426505 | + | NZ_CP022132.1 | Francisella halioticida |
| 6 | 255509 | 255709 | + | NZ_CP016796.1 | Francisella uliginis |
| 7 | 1552205 | 1552405 | - | NZ_CP038241.1 | Allofrancisella inopinata |
| 8 | 510439 | 510639 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 9 | 1480991 | 1481191 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 10 | 1187311 | 1187511 | - | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
| 11 | 272450 | 272650 | + | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 12 | 151876 | 152079 | + | NZ_CP021781.1 | Francisella adeliensis |
| 13 | 143333 | 143539 | - | NZ_CP009654.1 | Francisella frigiditurris |
| 14 | 3932028 | 3932219 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 15 | 132456 | 132647 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 16 | 1175029 | 1175208 | - | NZ_CP023559.1 | Salinicola tamaricis |
| 17 | 1967510 | 1967701 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 18 | 288938 | 289129 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 19 | 761757 | 761945 | - | NZ_CP021323.1 | Kushneria konosiri |
| 20 | 2537556 | 2537744 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 21 | 983793 | 983984 | - | NZ_CP048812.1 | Halomonas socia |
| 22 | 330891 | 331082 | + | NZ_AP018933.1 | Zymobacter palmae |
| 23 | 547287 | 547478 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 24 | 519911 | 520072 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 25 | 3624989 | 3625180 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 26 | 3513824 | 3514015 | - | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 27 | 1364234 | 1364422 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 28 | 3442561 | 3442752 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 29 | 3197153 | 3197344 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 30 | 2013232 | 2013423 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 31 | 1577209 | 1577400 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 32 | 4494706 | 4494891 | - | NZ_CP011129.1 | Lysobacter antibioticus |
| 33 | 3639466 | 3639657 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 34 | 641008 | 641190 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 35 | 1586334 | 1586534 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 36 | 4212696 | 4212881 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 37 | 258112 | 258276 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 38 | 1713320 | 1713514 | - | NZ_LR699114.1 | Aquicella lusitana |
| 39 | 480296 | 480460 | + | NZ_LR699119.1 | Aquicella siphonis |
| 40 | 2675335 | 2675535 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 41 | 4878006 | 4878197 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
| 42 | 4222632 | 4222823 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 43 | 1249182 | 1249379 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 44 | 2324977 | 2325153 | - | NZ_CP031700.1 | Neisseria zalophi |
| 45 | 1956731 | 1956907 | - | NZ_CP072524.1 | Neisseria sicca |
| 46 | 832736 | 832927 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 47 | 1430678 | 1430878 | - | NZ_CP064063.1 | Brucella anthropi |
| 48 | 483975 | 484166 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 49 | 1194749 | 1194949 | - | NC_010103.1 | Brucella canis ATCC 23365 |
| 50 | 1195860 | 1196060 | - | NC_004310.3 | Brucella suis 1330 |
| 51 | 1201648 | 1201848 | - | NC_009505.1 | Brucella ovis ATCC 25840 |
| 52 | 1202175 | 1202375 | - | NC_013119.1 | Brucella microti CCM 4915 |
| 53 | 791956 | 792156 | + | NC_003317.1 | Brucella melitensis bv. 1 str. 16M |
| 54 | 791946 | 792146 | + | NC_022905.1 | Brucella ceti TE10759-12 |
| 55 | 1211118 | 1211318 | - | NC_007618.1 | Brucella abortus 2308 |
| 56 | 1510721 | 1510921 | + | NZ_LT605585.1 | Brucella inopinata |
| 57 | 372941 | 373132 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 58 | 209708 | 209899 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 59 | 2818537 | 2818737 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 60 | 376427 | 376618 | + | NZ_CP059571.1 | Neisseria bacilliformis |
| 61 | 3298982 | 3299143 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017449.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.98 | 60 | 1789.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.98 | 60 | 1789.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 0.87 | 53 | 1479 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 0.98 | 60 | 1134.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 1.0 | 61 | 425 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 1.0 | 61 | 425 | same-strand | KH domain |
| 7 | PF00252.20 | 0.93 | 57 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 0.98 | 60 | 3.0 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 0.98 | 60 | 324.0 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF17136.6 | 0.98 | 60 | 705.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 11 | PF00673.23 | 1.0 | 61 | 1038 | same-strand | ribosomal L5P family C-terminus |
| 12 | PF00281.21 | 1.0 | 61 | 1038 | same-strand | Ribosomal protein L5 |
| 13 | PF00253.23 | 0.97 | 59 | 1594 | same-strand | Ribosomal protein S14p/S29e |
++ More..