Result : A6VYC0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein Mmwyl1_2530 |
| NCBI Accession ID | CP000749.1 |
| Organism | Marinomonas sp. (strain MWYL1) |
| Left | 2832354 |
| Right | 2832647 |
| Strand | - |
| Nucleotide Sequence | ATGAAACAGCATTTAATCGTAGAAGTATTTCGTTCTAGCAAGCATGATGGAATGTACTTGTATGTGGAAAAAAGCAAGGGATTGAAAGAAATCCCTGAAGAGTTAATGACTCGATTTGGTAAAGGCATCAGTGCGATGACTATGCTATTGACCAATGAAAGTAAGTTGGCTCGAGCTACGCCAGAGAATGTGACCAAAGGCATTCGTGAAAAAGGCTTTTATTTGCAATTACCACCAGCGAAAGACGAGTATTTGTTGGATTTGTATAAAACACCGACAGAAGCTGTTTACTAA |
| Sequence | MKQHLIVEVFRSSKHDGMYLYVEKSKGLKEIPEELMTRFGKGISAMTMLLTNESKLARATPENVTKGIREKGFYLQLPPAKDEYLLDLYKTPTEAVY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | A6VYC0 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3804735 | 3805028 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 2 | 1830824 | 1831117 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 3 | 2485403 | 2485696 | - | NZ_CP061081.1 | Marinomonas arctica |
| 4 | 1646024 | 1646317 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 5 | 2580279 | 2580521 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 6 | 1581682 | 1581975 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 7 | 2191338 | 2191574 | - | NZ_CP061941.1 | Marinomonas algicola |
| 8 | 2777080 | 2777322 | - | NZ_CP014226.1 | Halomonas chromatireducens |
| 9 | 1219148 | 1219390 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 10 | 1672868 | 1673110 | + | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 11 | 2409039 | 2409320 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 12 | 2896942 | 2897184 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 13 | 2271232 | 2271474 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 14 | 2706159 | 2706455 | + | NZ_CP048812.1 | Halomonas socia |
| 15 | 3786564 | 3786824 | - | NZ_CP021425.1 | Oleiphilus messinensis |
| 16 | 1734834 | 1735109 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 17 | 1708982 | 1709218 | + | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 18 | 2437424 | 2437696 | - | NZ_CP036422.1 | Halioglobus maricola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054301.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 1.0 | 18 | 2162.0 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF12169.10 | 1.0 | 18 | 2162.0 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 3 | PF00004.31 | 1.0 | 18 | 2202 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF12170.10 | 1.0 | 18 | 2162.0 | same-strand | DNA polymerase III tau subunit V interacting with alpha |
| 5 | PF13401.8 | 0.83 | 15 | 2161 | same-strand | AAA domain |
| 6 | PF02575.18 | 1.0 | 18 | 1822.0 | same-strand | YbaB/EbfC DNA-binding family |
| 7 | PF13662.8 | 0.94 | 17 | 1193 | same-strand | Toprim domain |
| 8 | PF02132.17 | 1.0 | 18 | 1201.5 | same-strand | RecR protein |
| 9 | PF01751.24 | 0.94 | 17 | 1193 | same-strand | Toprim domain |
| 10 | PF01612.22 | 1.0 | 18 | 46.5 | same-strand | 3'-5' exonuclease |
| 11 | PF00570.25 | 1.0 | 18 | 46.5 | same-strand | HRDC domain |
| 12 | PF03692.17 | 0.94 | 17 | 18 | same-strand | Putative zinc- or iron-chelating domain |
| 13 | PF00092.30 | 0.78 | 14 | 1003.0 | same-strand | von Willebrand factor type A domain |
| 14 | PF13768.8 | 0.67 | 12 | 1525.5 | same-strand | von Willebrand factor type A domain |
++ More..