Result : Q135C2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000283.1 |
| Organism | Rhodopseudomonas palustris (strain BisB5) |
| Left | 3436090 |
| Right | 3436389 |
| Strand | - |
| Nucleotide Sequence | ATGAGCACGACGATCCGGCAGGTCATGGTTCGTGGTCGCGTCCAGGGGGTCGGCTATCGCGCCTGGCTCGCGATGACCGCCGAGGCGCAGGGCCTCGAAGGCTGGGTCCGCAATCGCCGCGACGGCAGCGTCGAGGCGTTGTTGGCAGGGCGCGAGACGGTGGTGGCCGAGATGATCTCCCGATGCCGCACTGGCCCGTCGGCGGCCCATGTCGACGAGGTGATCGTCGAGGAGGCGGGGCAGGACGCCTTGAACCTGCGCTATGCGGGCGAGCGATTCTCGATCCTGTCGACGCTGTAA |
| Sequence | MSTTIRQVMVRGRVQGVGYRAWLAMTAEAQGLEGWVRNRRDGSVEALLAGRETVVAEMISRCRTGPSAAHVDEVIVEEAGQDALNLRYAGERFSILSTL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q135C2 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3487884 | 3488183 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 2 | 4611944 | 4612243 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 3 | 5749343 | 5749642 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 4 | 6172707 | 6173006 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 5 | 5482214 | 5482513 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 6 | 3852019 | 3852318 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 7 | 4300621 | 4300920 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 8 | 3133759 | 3134058 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 9 | 5838625 | 5838924 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 10 | 3945919 | 3946218 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 11 | 3532992 | 3533291 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 12 | 6236578 | 6236877 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 13 | 5278411 | 5278710 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 14 | 3115149 | 3115448 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 15 | 3141703 | 3142002 | + | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 16 | 3699532 | 3699831 | + | NZ_CP016428.1 | Bradyrhizobium icense |
| 17 | 1896134 | 1896433 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 18 | 2403894 | 2404193 | - | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 19 | 3549029 | 3549331 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 20 | 2983642 | 2983911 | - | NZ_AP014946.1 | Variibacter gotjawalensis |
| 21 | 4459315 | 4459572 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 22 | 1540121 | 1540420 | + | NZ_CP012946.1 | Blastochloris viridis |
| 23 | 3335072 | 3335326 | + | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 24 | 2444210 | 2444488 | - | NZ_CP034145.1 | Haloplanus aerogenes |
| 25 | 3423712 | 3423966 | + | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 26 | 2633115 | 2633369 | - | NZ_CP024935.1 | Paraburkholderia graminis |
| 27 | 962299 | 962565 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 28 | 2530738 | 2530992 | - | NZ_CP066076.1 | Paraburkholderia ginsengisoli |
| 29 | 1184946 | 1185194 | + | NZ_CP017562.1 | Paraburkholderia sprentiae WSM5005 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP058907.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02786.19 | 0.72 | 21 | 1012 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 2 | PF00289.24 | 0.72 | 21 | 1012 | same-strand | Biotin carboxylase, N-terminal domain |
| 3 | PF02785.21 | 0.72 | 21 | 1012 | same-strand | Biotin carboxylase C-terminal domain |
| 4 | PF18140.3 | 0.72 | 21 | 1012 | same-strand | Propionyl-coenzyme A carboxylase BT domain |
| 5 | PF00364.24 | 0.72 | 21 | 1012 | same-strand | Biotin-requiring enzyme |
| 6 | PF02222.24 | 0.72 | 21 | 1012 | same-strand | ATP-grasp domain |
++ More..