Result : Q12CR1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000316.1 |
| Organism | Polaromonas sp. (strain JS666 / ATCC BAA-500) |
| Left | 1805207 |
| Right | 1805488 |
| Strand | + |
| Nucleotide Sequence | ATGGCCAAAAGCTCCTCTTCCTCTTCCCCTTCCCCTGCTGCCGCTTCTGCGGCCACCACATCATCGGCTCCTCCATTACCTGCCAGCTATGAGGCTGCCCTGCAGGAGCTTGAGGGGCTGGTGGCTGGTCTCGAGTCGGGCCAGTTGCCGCTGGACCAATTGCTCACGGGCTACCAACGCGGGGCGCAGTTGCTGAAGTTCTGCCGCGACAAGCTTGAGGCGGTGGAAACCCAGATCAAGGTCCTGGAGGGCACGGAGCTCAAGCCCTGGGTGCAAGAGTAG |
| Sequence | MAKSSSSSSPSPAAASAATTSSAPPLPASYEAALQELEGLVAGLESGQLPLDQLLTGYQRGAQLLKFCRDKLEAVETQIKVLEGTELKPWVQE |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 18723656 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q12CR1 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1587084 | 1587365 | + | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 2 | 1358568 | 1358810 | + | NZ_CP035503.1 | Rhodoferax sediminis |
| 3 | 4299483 | 4299746 | - | NZ_CP019236.1 | Rhodoferax koreense |
| 4 | 1357860 | 1358087 | + | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 5 | 1204076 | 1204318 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 6 | 3129357 | 3129614 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 7 | 2196427 | 2196672 | - | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 8 | 1931912 | 1932178 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 9 | 3179737 | 3179973 | - | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 10 | 3990030 | 3990287 | - | NZ_CP043575.1 | Comamonas koreensis |
| 11 | 2809186 | 2809446 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 12 | 5227687 | 5227944 | + | NZ_CP047650.1 | Xylophilus rhododendri |
| 13 | 1932281 | 1932565 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 14 | 740435 | 740692 | + | NZ_CP029210.1 | Aquabacterium olei |
| 15 | 1130606 | 1130851 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 16 | 1185863 | 1186105 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 17 | 2952731 | 2953039 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 18 | 3265221 | 3265511 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 19 | 3050920 | 3051228 | - | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 20 | 818133 | 818417 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 21 | 2209794 | 2210102 | + | NZ_CP022990.1 | Paraburkholderia aromaticivorans |
| 22 | 234415 | 234723 | + | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 23 | 3119692 | 3120000 | - | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 24 | 2891988 | 2892296 | + | NZ_CP024935.1 | Paraburkholderia graminis |
| 25 | 923045 | 923362 | - | NC_010623.1 | Paraburkholderia phymatum STM815 |
| 26 | 2691950 | 2692204 | - | NZ_CP021455.1 | Comamonas serinivorans |
| 27 | 1813302 | 1813586 | + | NZ_CP068285.1 | Ralstonia syzygii subsp. celebesensis |
| 28 | 1359837 | 1360145 | + | NZ_CP024942.1 | Paraburkholderia terricola |
| 29 | 318014 | 318259 | + | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 30 | 2264979 | 2265245 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 31 | 1292304 | 1292543 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 32 | 2755057 | 2755350 | - | NZ_CP002581.1 | Burkholderia plantarii |
| 33 | 404631 | 404924 | - | NZ_CP035901.1 | Burkholderia glumae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008781.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00581.22 | 0.88 | 29 | 2501 | opposite-strand | Rhodanese-like domain |
| 2 | PF00848.21 | 1.0 | 33 | 288 | opposite-strand | Ring hydroxylating alpha subunit (catalytic domain) |
| 3 | PF00355.28 | 0.67 | 22 | 314.5 | opposite-strand | Rieske [2Fe-2S] domain |
| 4 | PF00348.19 | 1.0 | 33 | -3 | same-strand | Polyprenyl synthetase |
| 5 | PF13292.8 | 1.0 | 33 | 964 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 6 | PF02779.26 | 1.0 | 33 | 964 | same-strand | Transketolase, pyrimidine binding domain |
| 7 | PF02780.22 | 1.0 | 33 | 964 | same-strand | Transketolase, C-terminal domain |
++ More..