Result : Q11QC0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000383.1 |
| Organism | Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465) |
| Left | 3594023 |
| Right | 3594211 |
| Strand | - |
| Nucleotide Sequence | ATGAAAACTGCTGAAATAAAAGGTTTATCGGTAGAAGATTTAAAGCAACGTATCGTTGCTGAAAAAGAGAACTTGCACAAGCTGAAATTTGCGCATGCGATTTCTCCGATTGAGAATCCGATGAAAATAAGTCATACTCGTAAGCTGATCGCTCAATTGAGTACTGAACTTACTGCAAAAAGTAAATAA |
| Sequence | MKTAEIKGLSVEDLKQRIVAEKENLHKLKFAHAISPIENPMKISHTRKLIAQLSTELTAKSK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 17400776 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q11QC0 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 98
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3594023 | 3594211 | - | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 2 | 79246 | 79440 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 3 | 1915637 | 1915837 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 4 | 457868 | 458062 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 5 | 5531935 | 5532129 | + | NZ_CP014263.1 | Spirosoma montaniterrae |
| 6 | 1790462 | 1790656 | + | NZ_CP020105.1 | Spirosoma rigui |
| 7 | 3596114 | 3596308 | + | NC_014759.1 | Marivirga tractuosa DSM 4126 |
| 8 | 254573 | 254767 | - | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 9 | 252116 | 252310 | - | NZ_CP040106.1 | Echinicola rosea |
| 10 | 2032009 | 2032203 | - | NZ_CP030041.1 | Echinicola strongylocentroti |
| 11 | 5262547 | 5262756 | + | NZ_CP048222.1 | Rhodocytophaga rosea |
| 12 | 276559 | 276753 | + | NZ_CP010777.1 | Rufibacter radiotolerans |
| 13 | 3761692 | 3761886 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 14 | 173307 | 173501 | - | NZ_CP050063.1 | Spirosoma aureum |
| 15 | 6237521 | 6237715 | + | NZ_CP010429.1 | Spirosoma radiotolerans |
| 16 | 3037701 | 3037895 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 17 | 3283947 | 3284147 | + | NZ_CP047984.1 | Pontibacter russatus |
| 18 | 2633271 | 2633453 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 19 | 5274218 | 5274412 | + | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 20 | 3048542 | 3048736 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 21 | 1911208 | 1911396 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 22 | 1976049 | 1976249 | + | NZ_CP009621.1 | Pontibacter korlensis |
| 23 | 2849772 | 2849984 | + | NZ_CP040896.1 | Hymenobacter jejuensis |
| 24 | 1252408 | 1252590 | + | NZ_CP012836.1 | Algoriphagus sanaruensis |
| 25 | 3983899 | 3984108 | - | NZ_CP054139.1 | Mucilaginibacter mali |
| 26 | 1451284 | 1451478 | - | NZ_CP032382.1 | Chryseolinea soli |
| 27 | 3646679 | 3646873 | + | NZ_CP047897.1 | Nibribacter ruber |
| 28 | 2515450 | 2515650 | + | NZ_CP014766.1 | Pontibacter akesuensis |
| 29 | 4442012 | 4442224 | - | NZ_CP060723.1 | Pedobacter roseus |
| 30 | 2806168 | 2806368 | - | NZ_CP048106.1 | Pontibacter pudoricolor |
| 31 | 1141929 | 1142114 | - | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 32 | 674470 | 674682 | + | NZ_CP037922.1 | Hymenobacter radiodurans |
| 33 | 5048517 | 5048726 | + | NZ_CP024091.1 | Pedobacter ginsengisoli |
| 34 | 726829 | 727038 | + | NC_013061.1 | Pedobacter heparinus DSM 2366 |
| 35 | 3767207 | 3767407 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 36 | 520019 | 520225 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 37 | 4492786 | 4492986 | + | NZ_CP021235.1 | Pontibacter actiniarum |
| 38 | 1823972 | 1824166 | + | NC_018010.1 | Belliella baltica DSM 15883 |
| 39 | 3263306 | 3263491 | - | NZ_CP034161.1 | Epilithonimonas vandammei |
| 40 | 2137980 | 2138189 | - | NZ_CP066775.1 | Mucilaginibacter ginkgonis |
| 41 | 1698229 | 1698438 | - | NZ_CP042437.1 | Mucilaginibacter ginsenosidivorax |
| 42 | 1641689 | 1641883 | - | NZ_LR134404.1 | Weeksella virosa |
| 43 | 6715122 | 6715331 | + | NZ_CP032869.1 | Mucilaginibacter celer |
| 44 | 3759397 | 3759606 | - | NZ_CP071878.1 | Mucilaginibacter gossypii |
| 45 | 5141988 | 5142191 | - | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 46 | 3554881 | 3555084 | - | NC_017770.1 | Solitalea canadensis DSM 3403 |
| 47 | 5086833 | 5087042 | - | NZ_CP042436.1 | Mucilaginibacter ginsenosidivorans |
| 48 | 2877048 | 2877242 | + | NZ_CP012643.1 | Rufibacter tibetensis |
| 49 | 1106792 | 1106995 | + | NZ_AP017313.1 | Mucilaginibacter gotjawali |
| 50 | 747872 | 748057 | + | NZ_CP033929.1 | Chryseobacterium indoltheticum |
| 51 | 776065 | 776256 | - | NZ_CP011071.1 | Muricauda lutaonensis |
| 52 | 2749174 | 2749362 | - | NZ_CP023049.2 | Chryseobacterium piperi |
| 53 | 4029222 | 4029407 | - | NZ_CP033914.1 | Chryseobacterium shandongense |
| 54 | 1699886 | 1700071 | + | NZ_CP033932.1 | Chryseobacterium bernardetii |
| 55 | 1468232 | 1468423 | + | NC_013222.1 | Robiginitalea biformata HTCC2501 |
| 56 | 2742437 | 2742622 | - | NZ_CP050995.1 | Chryseobacterium gallinarum |
| 57 | 4044426 | 4044611 | + | NZ_LR134289.1 | Chryseobacterium gleum |
| 58 | 3680398 | 3680583 | + | NZ_CP033926.1 | Chryseobacterium joostei |
| 59 | 699894 | 700079 | + | NZ_LR134386.1 | Chryseobacterium nakagawai |
| 60 | 1835488 | 1835673 | + | NZ_CP033924.1 | Chryseobacterium lactis |
| 61 | 4575858 | 4576061 | - | NZ_CP022743.1 | Mucilaginibacter xinganensis |
| 62 | 3177039 | 3177224 | + | NZ_CP022986.1 | Chryseobacterium camelliae |
| 63 | 2548130 | 2548315 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 64 | 4172045 | 4172230 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 65 | 1498894 | 1499097 | + | NZ_CP006828.1 | Ornithobacterium rhinotracheale ORT-UMN 88 |
| 66 | 1514856 | 1515044 | - | NZ_CP015199.1 | Chryseobacterium glaciei |
| 67 | 128626 | 128820 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 68 | 1882852 | 1883037 | - | NZ_LR215974.1 | Chryseobacterium taihuense |
| 69 | 1976156 | 1976341 | + | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 70 | 2814619 | 2814804 | - | NZ_CP014224.1 | Wenyingzhuangia fucanilytica |
| 71 | 1198812 | 1199027 | + | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 72 | 183551 | 183763 | + | NZ_AP017422.1 | Filimonas lacunae |
| 73 | 830465 | 830656 | - | NZ_CP017774.1 | Flavobacterium commune |
| 74 | 3496234 | 3496428 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 75 | 175379 | 175570 | - | NZ_CP028811.1 | Flavobacterium magnum |
| 76 | 3094634 | 3094831 | + | NZ_CP015402.2 | Muribaculum intestinale |
| 77 | 1846136 | 1846351 | - | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 78 | 1178925 | 1179116 | + | NZ_CP017688.1 | Flavobacterium crassostreae |
| 79 | 1926812 | 1927000 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 80 | 5868544 | 5868750 | + | NZ_CP048113.1 | Chitinophaga agri |
| 81 | 1124043 | 1124261 | - | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 82 | 1496448 | 1496603 | - | NZ_CP011390.1 | Flavisolibacter tropicus |
| 83 | 3747328 | 3747480 | - | NZ_CP032489.1 | Arachidicoccus soli |
| 84 | 5811656 | 5811835 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 85 | 1932212 | 1932421 | + | NZ_CP037755.1 | Pseudocnuella soli |
| 86 | 1786058 | 1786249 | + | NZ_AP019736.1 | Alistipes dispar |
| 87 | 1726101 | 1726292 | + | NZ_CP020918.1 | Flavobacterium faecale |
| 88 | 1396403 | 1396594 | + | NZ_LR027382.1 | Alistipes megaguti |
| 89 | 877879 | 878034 | - | NC_015321.1 | Fluviicola taffensis DSM 16823 |
| 90 | 1258172 | 1258366 | - | NZ_AP019735.1 | Alistipes communis |
| 91 | 2491720 | 2491932 | - | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 92 | 1968972 | 1969178 | + | NC_013132.1 | Chitinophaga pinensis DSM 2588 |
| 93 | 2652172 | 2652345 | + | NZ_CP042434.1 | Arachidicoccus ginsenosidivorans |
| 94 | 2445703 | 2445912 | - | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 95 | 863776 | 863973 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 96 | 3961279 | 3961488 | - | NZ_CP032157.1 | Paraflavitalea soli |
| 97 | 4672109 | 4672318 | + | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 98 | 2313399 | 2313599 | + | NZ_CP023777.1 | Chitinophaga caeni |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008255.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.94 | 92 | 1548.0 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 1.0 | 98 | 992.0 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 0.98 | 96 | 991.5 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 0.96 | 94 | 660.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 0.71 | 70 | 657.0 | same-strand | KOW motif |
| 6 | PF00238.21 | 0.97 | 95 | 274 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 0.99 | 97 | 14 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 0.98 | 96 | 13.0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 0.99 | 97 | 517 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 0.99 | 97 | 517 | same-strand | KH domain |
| 11 | PF00237.21 | 0.99 | 97 | 1294 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 0.99 | 97 | 1695 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 1.0 | 98 | 1976.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 0.99 | 97 | 1976 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..