Result : Q118B3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000393.1 |
| Organism | Trichodesmium erythraeum (strain IMS101) |
| Left | 1180763 |
| Right | 1180939 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGTACCAAAGAAGAGAACCTCAAAATCTAAGAAAAATATGCGGAAAGCTAACTGGAAAAACCAGGCAAAACTAGCTGCAAAGAAGGCACTATCCCTAGGTAAATCTGTTGAAACTCAACGTTCCCATAGTTTTGTACACCCAAGATATGAAGAGGAAGAAGAAGAAGATTAA |
| Sequence | MAVPKKRTSKSKKNMRKANWKNQAKLAAKKALSLGKSVETQRSHSFVHPRYEEEEEED |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q118B3 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6860891 | 6861070 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 2 | 1327697 | 1327876 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 3 | 5875863 | 5876036 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 4 | 2852058 | 2852237 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 5 | 3060120 | 3060296 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 6 | 900624 | 900797 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 7 | 2759789 | 2759965 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 8 | 742160 | 742342 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 9 | 1091350 | 1091526 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 10 | 2008104 | 2008271 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 11 | 2189659 | 2189835 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 12 | 3404048 | 3404221 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 13 | 5820313 | 5820486 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 14 | 983771 | 983944 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 15 | 4288085 | 4288267 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 16 | 4484740 | 4484913 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 17 | 5130540 | 5130713 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 18 | 2186852 | 2187025 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 19 | 3147446 | 3147619 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 20 | 1991295 | 1991474 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 21 | 2453573 | 2453740 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 22 | 2133450 | 2133623 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 23 | 2970985 | 2971164 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 24 | 5887636 | 5887809 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 25 | 1219448 | 1219627 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 26 | 1883793 | 1883975 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 27 | 2005312 | 2005494 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 28 | 1287690 | 1287866 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 29 | 3716085 | 3716258 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
++ More..