| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | CP000393.1 |
| Organism | Trichodesmium erythraeum (strain IMS101) |
| Left | 4653896 |
| Right | 4654144 |
| Strand | - |
| Nucleotide Sequence | ATGCCTTTCCCAAAAATAGCAGAAGTTAGGGAATTGAGTGATGAAGAAATTGCTAATGAAATAGCTAAGGTTAAGCGGGAATTGTTTGATTTACGCATCCTTAAAGCTACAGGAAGAATAGAAAAAACACACCTATTCAAGCATAACCGCCATCGACTGGCTCAGTTATTAACAATAGAAAAAGAACGGGAATTAGCTAAAAATGCAGAAGCTTCTACTACTGTTTCCACAGTAGAGAATACTCAGTAA |
| Sequence | MPFPKIAEVRELSDEEIANEIAKVKRELFDLRILKATGRIEKTHLFKHNRHRLAQLLTIEKERELAKNAEASTTVSTVENTQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q110B5 |
| ORF Length (Amino Acid) | 82 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5491608 | 5491853 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 2 | 2618214 | 2618456 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 3 | 174242 | 174469 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 4 | 217184 | 217417 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 5461982 | 5462209 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 6 | 4468984 | 4469211 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 7 | 5627737 | 5627964 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 8 | 6148686 | 6148913 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 9 | 4000279 | 4000506 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 10 | 2171016 | 2171240 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 11 | 1924258 | 1924491 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 12 | 5287593 | 5287811 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 13 | 4115144 | 4115356 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 14 | 3765277 | 3765537 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00410.21 | 0.93 | 13 | 1711 | same-strand | Ribosomal protein S8 |
| 2 | PF00673.23 | 1.0 | 14 | 1133.5 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 1.0 | 14 | 1133.5 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 1.0 | 14 | 670.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 1.0 | 14 | 670.0 | same-strand | KOW motif |
| 6 | PF00238.21 | 1.0 | 14 | 301.5 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 1.0 | 14 | 7.0 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 14 | 4.0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 14 | 501.5 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 14 | 501.5 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 14 | 1334.5 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 0.93 | 13 | 1775 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 0.93 | 13 | 2169 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 0.93 | 13 | 2169 | same-strand | Ribosomal Proteins L2, RNA binding domain |