Result : Q10YY8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000393.1 |
| Organism | Trichodesmium erythraeum (strain IMS101) |
| Left | 5265502 |
| Right | 5265750 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAAGCAATCTAATATTAATTCGGTAGAACTAAGCCGTAAGTCTGAGGAGCTAATCAAAGCTTCTTCTAATCGCTATCGGGCTGTGGTACAAGTAGCTAATCGTGCCAAGCGTCGTCGTTATGAAGATTTTGATAATTTTGATGAGCAAGCAGTCAAGCCAGTCATTCGTGCTGTATTGGAAATGTCTGATGAGTTGATGCAACCAGAAATAATTAGTGAAGTTGGCAATAATATAGATAGATAA |
| Sequence | MQKQSNINSVELSRKSEELIKASSNRYRAVVQVANRAKRRRYEDFDNFDEQAVKPVIRAVLEMSDELMQPEIISEVGNNIDR |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q10YY8 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1488940 | 1489170 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 2 | 2707576 | 2707803 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 3 | 2551274 | 2551519 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 4 | 5614286 | 5614522 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 5 | 4895816 | 4896049 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 6 | 4174304 | 4174531 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 7 | 6202154 | 6202390 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 8 | 1671462 | 1671698 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 9 | 4713276 | 4713512 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 10 | 7508533 | 7508769 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 11 | 3541341 | 3541568 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 12 | 2766408 | 2766644 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 13 | 3770722 | 3770931 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 14 | 2592577 | 2592813 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 15 | 2871850 | 2872071 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 16 | 1857533 | 1857769 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 17 | 745937 | 746164 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 18 | 3772961 | 3773197 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 19 | 3777900 | 3778127 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 20 | 2215773 | 2216006 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 21 | 2346754 | 2346987 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 22 | 53407 | 53640 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 23 | 1806983 | 1807213 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 24 | 1736313 | 1736522 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 25 | 216559 | 216780 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 26 | 3391125 | 3391355 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 27 | 3635756 | 3635989 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 28 | 2266714 | 2266944 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019729.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08848.13 | 0.68 | 19 | 690 | same-strand | Domain of unknown function (DUF1818) |
++ More..