Result : Q10891
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein Rv0095c |
| NCBI Accession ID | |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLANSREELVEVFDALDADLDRLDEVSFEVLSTPERLRSLERLECLARRLPAAQHTLINQLDTQASEEELGGTLCCALANRLRITKPEAGRRSAEAKP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9634230 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q10891 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 104805 | 105101 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 113469 | 113783 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 3 | 4438176 | 4438436 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 4 | 2589077 | 2589385 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
++ More..