Result : Q0VS71
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AM286690.1 |
| Organism | Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) |
| Left | 582526 |
| Right | 582813 |
| Strand | - |
| Nucleotide Sequence | ATGGCCATTAATTCCAAGGTGGTTGCCCAGGTGGCCCATCTGGCACGTCTAAAAGTGGACCCCCAGGACAGCAACGCCCTGTCCGACCGTCTGAATGACATCCTCGCGATGGTAGACCAGCTGCAGCAGGCCGACGTGGACGGCGTGGCCCCCATGGCCCACCCGCTGGACGTTACTCAACCTTTGCGCGACGACGTAGTGACGGAACCCAACATCCGTGACAAGGCACTGGCCATTGCCCCGGCAGTTGAAAACGGCTGCTTCTTGGTTCCCCGGGTCATTGAATAA |
| Sequence | MAINSKVVAQVAHLARLKVDPQDSNALSDRLNDILAMVDQLQQADVDGVAPMAHPLDVTQPLRDDVVTEPNIRDKALAIAPAVENGCFLVPRVIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 16878126 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q0VS71 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 85
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 582526 | 582813 | - | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 2 | 3994811 | 3995098 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
| 3 | 951650 | 951937 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 4 | 1467085 | 1467333 | - | NZ_CP060092.1 | Teredinibacter purpureus |
| 5 | 800596 | 800883 | - | NZ_CP013189.1 | Pseudohongiella spirulinae |
| 6 | 3857823 | 3858110 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 7 | 1297972 | 1298259 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
| 8 | 1076409 | 1076696 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 9 | 976970 | 977257 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 10 | 1190373 | 1190660 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 11 | 4070591 | 4070872 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 12 | 5962898 | 5963185 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 13 | 3335250 | 3335537 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 14 | 2391288 | 2391575 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 15 | 2640666 | 2640953 | + | NZ_CP065135.1 | Halomonas venusta |
| 16 | 4232106 | 4232393 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 17 | 1458026 | 1458313 | - | NC_021291.1 | Spiribacter salinus M19-40 |
| 18 | 1024513 | 1024800 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 19 | 128913 | 129200 | - | NZ_CP022579.1 | Oryzomicrobium terrae |
| 20 | 3370403 | 3370690 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 21 | 1202303 | 1202590 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 22 | 5028045 | 5028332 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 23 | 2642050 | 2642337 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 24 | 990531 | 990818 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 25 | 2265936 | 2266175 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 26 | 4772487 | 4772774 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 27 | 1056502 | 1056789 | - | NC_014532.2 | Halomonas elongata DSM 2581 |
| 28 | 4058098 | 4058385 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 29 | 4833616 | 4833903 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 30 | 3020322 | 3020609 | - | NZ_CP048812.1 | Halomonas socia |
| 31 | 1186806 | 1187093 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 32 | 2202193 | 2202480 | + | NZ_CP043420.1 | Kushneria phosphatilytica |
| 33 | 3918748 | 3919035 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 34 | 2353210 | 2353497 | + | NZ_CP048602.1 | Halomonas piezotolerans |
| 35 | 4007689 | 4007976 | - | NZ_CP022684.1 | Ketobacter alkanivorans |
| 36 | 3608901 | 3609188 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 37 | 4919799 | 4920086 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 38 | 4987486 | 4987773 | + | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 39 | 5037595 | 5037882 | + | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 40 | 3961820 | 3962107 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 41 | 18773 | 19060 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 42 | 5018377 | 5018664 | + | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 43 | 1238781 | 1239068 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 44 | 1264711 | 1264998 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 45 | 4855866 | 4856153 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 46 | 1646086 | 1646373 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 47 | 976836 | 977123 | - | NZ_CP036422.1 | Halioglobus maricola |
| 48 | 1515362 | 1515649 | - | NZ_CP020931.1 | Marinobacter salarius |
| 49 | 1045545 | 1045832 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 50 | 3895450 | 3895737 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 51 | 1223797 | 1224084 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 52 | 3472919 | 3473206 | + | NZ_CP072793.1 | Thiothrix unzii |
| 53 | 1562937 | 1563224 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 54 | 1111304 | 1111591 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 55 | 1229841 | 1230128 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 56 | 5013671 | 5013961 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 57 | 5444971 | 5445258 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 58 | 2720851 | 2721138 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 59 | 2514749 | 2515036 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 60 | 1176502 | 1176789 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 61 | 4389584 | 4389868 | - | NZ_CP053069.1 | Usitatibacter rugosus |
| 62 | 1599768 | 1600055 | - | NC_022664.1 | Spiribacter curvatus |
| 63 | 950307 | 950594 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 64 | 511264 | 511551 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 65 | 810940 | 811227 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 66 | 1038860 | 1039147 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 67 | 2774888 | 2775175 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 68 | 2595169 | 2595456 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 69 | 443206 | 443493 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 70 | 2571403 | 2571690 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 71 | 449285 | 449572 | - | NZ_CP017715.1 | Marinobacter salinus |
| 72 | 796925 | 797212 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 73 | 2931727 | 2932014 | + | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 74 | 3539492 | 3539779 | + | NZ_CP021323.1 | Kushneria konosiri |
| 75 | 3141866 | 3142153 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 76 | 2766042 | 2766329 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 77 | 3009422 | 3009709 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 78 | 3356058 | 3356345 | - | NZ_CP021358.1 | Kushneria marisflavi |
| 79 | 3813272 | 3813556 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 80 | 2845716 | 2845967 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 81 | 2656630 | 2656917 | + | NZ_CP031093.1 | Hydrocarboniclastica marina |
| 82 | 2361305 | 2361592 | + | NZ_AP018933.1 | Zymobacter palmae |
| 83 | 4194635 | 4194922 | + | NZ_CP059082.1 | Halomonas titanicae |
| 84 | 368515 | 368802 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 85 | 3270342 | 3270629 | + | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013189.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02934.17 | 1.0 | 85 | 1505 | same-strand | GatB/GatE catalytic domain |
| 2 | PF02637.20 | 1.0 | 85 | 1505 | same-strand | GatB domain |
| 3 | PF01425.23 | 0.99 | 84 | 21.0 | same-strand | Amidase |
| 4 | PF06723.15 | 0.99 | 84 | 214.5 | opposite-strand | MreB/Mbl protein |
| 5 | PF14450.8 | 0.89 | 76 | 211.0 | opposite-strand | Cell division protein FtsA |
| 6 | PF04085.16 | 0.99 | 84 | 1406.0 | opposite-strand | rod shape-determining protein MreC |
| 7 | PF04093.14 | 0.99 | 84 | 2339.0 | opposite-strand | rod shape-determining protein MreD |
| 8 | PF02545.16 | 0.84 | 71 | 2877 | opposite-strand | Maf-like protein |
| 9 | PF10150.11 | 0.76 | 65 | 3505 | opposite-strand | Ribonuclease E/G family |
++ More..