ProsmORF-pred
Result : A6VPR2
Protein Information
Information Type Description
Protein name Protein RnfH
NCBI Accession ID CP000746.1
Organism Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / 130Z)
Left 1769939
Right 1770241
Strand -
Nucleotide Sequence ATGGAACAAATAAATATCGAAATCGCTTACGCCTATCCGCATAATCACTATTTGAAATCCTTTACATTAGATGCGGGAACAACCGTGCAGTCCGCCATTTTGCAATCAGGTATTTTAGCCCAATATACGGATATCGATTTACGTAAAAATAAGATCGGTATTTTTGCCCGACCGGTAAAATTAACGGATGTATTGAAAAATGGTGATCGTATCGAAATTTACCGTCCGTTATTGGCGGATCCGAAAGAAATCCGCCGTAAACGCGCCGCTCAGCAGGCAGCCCGGCAAAAGGGAAAAATATAA
Sequence MEQINIEIAYAYPHNHYLKSFTLDAGTTVQSAILQSGILAQYTDIDLRKNKIGIFARPVKLTDVLKNGDRIEIYRPLLADPKEIRRKRAAQQAARQKGKI
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states.
Pubmed ID 21118570
Domain CDD:421700
Functional Category Antitoxin_type_2
Uniprot ID A6VPR2
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 218
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 125417 125749 + NZ_CP015031.1 Basfia succiniciproducens
2 520183 520515 + NC_006300.1 [Mannheimia] succiniciproducens MBEL55E
3 702295 702603 - NZ_LS483429.1 Haemophilus aegyptius
4 768184 768498 - NZ_CP040863.1 Rodentibacter heylii
5 626437 626745 - NZ_CP009610.1 Haemophilus influenzae
6 77645 77953 - NZ_LS483458.1 Haemophilus haemolyticus
7 2236021 2236314 - NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
8 925812 926105 - NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
9 293535 293801 - NZ_CP030753.1 Actinobacillus pleuropneumoniae
10 1254152 1254451 - NZ_LT906448.1 Pasteurella dagmatis
11 1165185 1165490 + NZ_LT906463.1 Haemophilus pittmaniae
12 1576949 1577248 + NZ_CP028926.1 Pasteurella multocida
13 1377468 1377746 - NZ_CP029206.1 Actinobacillus porcitonsillarum
14 296427 296723 - NZ_CP009159.1 Actinobacillus suis ATCC 33415
15 272804 273100 - NZ_CP007715.1 Actinobacillus equuli subsp. equuli
16 1208643 1208942 - NZ_CP015425.1 [Haemophilus] ducreyi
17 716759 717055 + NZ_CP016604.1 Otariodibacter oris
18 1183617 1183886 - NZ_CP061280.1 Mannheimia bovis
19 761740 762009 - NZ_CP006944.1 Mannheimia varigena USDA-ARS-USMARC-1312
20 1164674 1164940 + NZ_CP015029.1 Frederiksenia canicola
21 868036 868320 + NZ_CP006954.1 Bibersteinia trehalosi USDA-ARS-USMARC-188
22 702666 702935 + NC_021883.1 Mannheimia haemolytica USMARC_2286
23 1228450 1228740 - NZ_LR134510.1 Actinobacillus delphinicola
24 1322770 1323063 + NZ_CP016180.1 Pasteurella skyensis
25 723356 723619 - NC_011852.1 Glaesserella parasuis SH0165
26 1269758 1270000 - NZ_CP055305.1 Mannheimia pernigra
27 645376 645630 - NZ_CP042941.1 Atlantibacter hermannii
28 1140094 1140336 - NZ_CP046531.1 Mannheimia ovis
29 1574585 1574878 + NZ_CP048796.1 Providencia vermicola
30 877885 878178 + NZ_CP025799.1 Dickeya zeae
31 3500668 3500964 - NZ_CP029736.1 Providencia rettgeri
32 3660186 3660452 + NZ_CP044098.1 Citrobacter portucalensis
33 1294481 1294741 - NZ_AP019007.1 Enterobacter oligotrophicus
34 5062905 5063171 - NZ_LT556085.1 Citrobacter amalonaticus
35 2710632 2710898 - NC_013716.1 Citrobacter rodentium ICC168
36 1450737 1451030 + NC_012962.1 Photorhabdus asymbiotica
37 882318 882611 + NZ_CP031560.1 Dickeya dianthicola
38 2299469 2299765 - NZ_CP031123.2 Providencia huaxiensis
39 2339497 2339790 + NZ_CP023536.1 Providencia alcalifaciens
40 4004651 4004944 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
41 1293787 1294080 + NZ_CP072455.1 Xenorhabdus budapestensis
42 1204688 1204978 + NZ_CP054254.1 Klebsiella variicola
43 512950 513210 + NZ_CP011104.1 Photorhabdus thracensis
44 3877003 3877263 - NZ_CP043318.1 Enterobacter chengduensis
45 1710045 1710329 - NZ_CP009787.1 Yersinia rohdei
46 948776 949069 + NC_014500.1 Dickeya dadantii 3937
47 4096782 4097072 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
48 2825581 2825847 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
49 478780 479052 - NZ_CP026047.1 Raoultella planticola
50 1775872 1776138 + NZ_CP045205.1 Citrobacter telavivensis
51 1214926 1215180 + NZ_CP046672.1 Raoultella ornithinolytica
52 1871848 1872141 - NZ_CP009460.1 Dickeya fangzhongdai
53 3566134 3566385 - NZ_CP027986.1 Enterobacter sichuanensis
54 3591343 3591606 - NZ_CP017184.1 Enterobacter roggenkampii
55 3677862 3678122 + NZ_CP025034.2 Enterobacter sp. SGAir0187
56 1165589 1165855 + NZ_CP041247.1 Raoultella electrica
57 1445529 1445795 - NZ_CP033744.1 Citrobacter freundii
58 3754633 3754893 - NC_012912.1 Dickeya chrysanthemi Ech1591
59 4833408 4833668 + NZ_CP045769.1 Enterobacter cancerogenus
60 3037397 3037690 + NZ_CP015137.1 Dickeya solani IPO 2222
61 1081590 1081856 + NZ_AP023184.1 Buttiauxella agrestis
62 3529718 3529969 - NZ_CP012871.1 [Enterobacter] lignolyticus
63 1295066 1295335 + NZ_CP014007.2 Kosakonia oryzae
64 3669829 3670080 - NZ_CP009756.1 Enterobacter cloacae
65 1179627 1179890 + NZ_CP013990.1 Leclercia adecarboxylata
66 2909162 2909428 - NZ_LN907827.1 Erwinia gerundensis
67 1170336 1170590 + NZ_LR134475.1 Klebsiella aerogenes
68 1106118 1106378 + NZ_LR134531.1 Pragia fontium
69 3037606 3037899 - NZ_FO704550.1 Xenorhabdus doucetiae
70 3274176 3274466 - NZ_LR134340.1 Escherichia marmotae
71 3542619 3542903 - NZ_CP046293.1 Yersinia intermedia
72 854392 854658 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
73 3671468 3671734 - NC_009792.1 Citrobacter koseri ATCC BAA-895
74 660349 660615 + NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
75 1697181 1697435 + NZ_CP051548.1 Phytobacter diazotrophicus
76 734585 734851 - NZ_CP053416.1 Salmonella bongori
77 4830074 4830334 + NZ_CP017279.1 Enterobacter ludwigii
78 3397729 3397995 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
79 428000 428293 + NZ_CP060401.1 Xenorhabdus nematophila
80 3870738 3871007 - NZ_CP015113.1 Kosakonia radicincitans
81 2287942 2288229 - NZ_CP023529.1 Lelliottia amnigena
82 947451 947744 + NZ_FO704551.1 Xenorhabdus poinarii G6
83 1583270 1583563 + NZ_LS483422.1 Providencia heimbachae
84 2752547 2752813 - NC_004337.2 Shigella flexneri 2a str. 301
85 3326273 3326539 - NZ_CP012264.1 Cronobacter condimenti 1330
86 2754008 2754274 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
87 1361461 1361715 + NZ_CP060111.1 Klebsiella michiganensis
88 4297455 4297724 + NZ_CP016337.1 Kosakonia sacchari
89 3773110 3773403 - NC_012880.1 Musicola paradisiaca Ech703
90 4339957 4340226 + NZ_CP045300.1 Kosakonia arachidis
91 2723093 2723359 - NZ_AP014857.1 Escherichia albertii
92 4021273 4021539 + NZ_CP057657.1 Escherichia fergusonii
93 3569807 3570067 - NC_015968.1 Enterobacter soli
94 1116769 1117011 + NZ_CP045845.1 Kluyvera intermedia
95 1209302 1209592 + NZ_CP065838.1 Klebsiella quasipneumoniae
96 1023607 1023873 + NZ_CP061527.1 Shigella dysenteriae
97 3521827 3522120 - NZ_CP042220.2 Dickeya poaceiphila
98 1447985 1448239 + NZ_CP036175.1 Klebsiella huaxiensis
99 654767 655027 + NZ_CP034035.1 Brenneria rubrifaciens
100 841991 842233 + NZ_LT615367.1 Dickeya aquatica
101 345724 346017 - NZ_CP026364.1 Proteus hauseri
102 1154983 1155267 + NZ_CP043727.1 Yersinia canariae
103 3558799 3559062 - NZ_AP022508.1 Enterobacter bugandensis
104 365658 365912 + NZ_CP011602.1 Phytobacter ursingii
105 3474150 3474416 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
106 863787 864077 + NZ_LR134201.1 Cedecea lapagei
107 1123040 1123324 + NZ_CP011118.1 Yersinia enterocolitica
108 269682 269966 - NZ_CP011254.1 Serratia fonticola
109 93426 93719 + NZ_CP016176.1 Xenorhabdus hominickii
110 1252512 1252769 + NZ_CP050508.1 Raoultella terrigena
111 3062377 3062661 + NZ_CP007230.1 Yersinia similis
112 2507702 2507989 + NZ_CP023706.1 Edwardsiella tarda
113 3804941 3805225 + NZ_CP009781.1 Yersinia aldovae 670-83
114 3101693 3101986 - NC_013892.1 Xenorhabdus bovienii SS-2004
115 738725 738982 + NZ_CP022741.1 Vibrio qinghaiensis
116 2960970 2961254 - NC_012779.2 Edwardsiella ictaluri 93-146
117 273775 274059 - NZ_CP065640.1 Serratia rubidaea
118 121502 121768 + NZ_CP027107.1 Cronobacter sakazakii
119 863180 863464 - NZ_CP006664.1 Edwardsiella anguillarum ET080813
120 905001 905267 + NZ_CP023525.1 Cedecea neteri
121 4152430 4152714 - NC_015567.1 Serratia plymuthica AS9
122 3489903 3490187 - NZ_CP032487.1 Yersinia hibernica
123 4103305 4103589 - NZ_LR134494.1 Serratia quinivorans
124 4080768 4081052 - NZ_CP048784.1 Serratia liquefaciens
125 942430 942699 + NZ_CP046268.1 Vibrio spartinae
126 2379092 2379376 + NZ_CP007044.2 Chania multitudinisentens RB-25
127 2636829 2637122 - NZ_CP047349.1 Proteus terrae subsp. cibarius
128 1054165 1054416 + NZ_CP050150.1 Hafnia alvei
129 2933272 2933577 + NZ_AP022853.1 Sulfurimicrobium lacus
130 1762166 1762435 - NZ_CP049115.1 Pantoea stewartii
131 3863109 3863372 - NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
132 3297715 3297978 - NZ_CP014137.1 Brenneria goodwinii
133 810753 811040 + NZ_CP016043.1 Edwardsiella hoshinae
134 4621975 4622253 + NZ_CP038469.1 Citrobacter tructae
135 3247217 3247483 - NZ_CP061511.1 Mixta calida
136 2049484 2049777 - NC_010554.1 Proteus mirabilis HI4320
137 3191177 3191461 - NZ_LR134373.1 Yersinia pseudotuberculosis
138 2690996 2691277 + NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
139 993099 993359 + NZ_CP038853.1 Pantoea vagans
140 2575970 2576239 - NZ_LS483470.1 Leminorella richardii
141 3112964 3113245 - NZ_CP015749.1 Pectobacterium parmentieri
142 2040829 2041071 - NZ_AP018685.1 Vibrio rumoiensis
143 3184064 3184339 - NZ_CP015581.1 Tatumella citrea
144 2501849 2502133 - NZ_CP067057.1 Rahnella aceris
145 4702071 4702352 + NZ_CP017482.1 Pectobacterium polaris
146 3309375 3309659 - NZ_CP016948.1 Serratia surfactantfaciens
147 2610638 2610922 - NZ_CP029185.2 Limnobaculum parvum
148 3680595 3680864 - NZ_CP063425.1 Kosakonia pseudosacchari
149 1072300 1072584 + NZ_CP071320.1 Serratia ureilytica
150 3995792 3996076 - NZ_CP038662.1 Serratia nematodiphila
151 488561 488872 - NZ_CP041660.1 Catenovulum sediminis
152 1214269 1214553 + NZ_CP006569.1 Sodalis praecaptivus
153 4024499 4024783 - NZ_LT906479.1 Serratia ficaria
154 1019197 1019457 + NZ_CP045720.1 Pantoea eucalypti
155 3811406 3811660 - NC_014306.1 Erwinia billingiae Eb661
156 4563971 4564255 - NZ_CP054043.1 Yersinia mollaretii ATCC 43969
157 855993 856274 + NZ_CP034938.1 Pectobacterium odoriferum
158 3461881 3462147 - NZ_CP026377.1 Mixta gaviniae
159 2606058 2606324 - NZ_CP028271.1 Mixta intestinalis
160 748635 748916 - NZ_CP047495.1 Pectobacterium brasiliense
161 2681680 2681946 + NZ_CP011451.1 Nitrosomonas communis
162 2179559 2179828 - NC_013166.1 Kangiella koreensis DSM 16069
163 2230124 2230402 - NZ_AP019651.1 Vibrio taketomensis
164 443664 443942 + NZ_AP019657.1 Vibrio ponticus
165 5107364 5107630 - NZ_CP040428.1 Jejubacter calystegiae
166 2594740 2595027 + NZ_CP019706.1 Pantoea alhagi
167 1325234 1325518 - NZ_CP011078.1 Yersinia ruckeri
168 813927 814205 + NZ_CP009354.1 Vibrio tubiashii ATCC 19109
169 3265249 3265515 - NZ_CP012257.1 Cronobacter universalis NCTC 9529
170 2354737 2355018 - NZ_CP047475.1 Vibrio astriarenae
171 2465019 2465291 - NZ_CP040449.1 Aeromonas simiae
172 2021554 2021847 - NZ_CP025120.1 Kangiella profundi
173 2236115 2236450 - NZ_CP009977.1 Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759
174 3040508 3040780 - NZ_CP034148.1 Pantoea agglomerans
175 569510 569788 + NZ_CP016414.1 Vibrio scophthalmi
176 2806318 2806602 - NZ_CP034752.1 Jinshanibacter zhutongyuii
177 828473 828754 + NZ_CP009125.1 Pectobacterium atrosepticum
178 677332 677595 + NZ_AP018689.1 Vibrio aphrogenes
179 2983586 2983864 - NC_013456.1 Vibrio antiquarius
180 2586370 2586654 - NZ_CP031781.1 Vibrio parahaemolyticus
181 2785090 2785404 + NZ_CP064781.1 Azospira restricta
182 5052520 5052783 - NZ_CP020388.1 Pluralibacter gergoviae
183 955730 955996 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
184 2546132 2546395 - NZ_LT960611.1 Vibrio tapetis subsp. tapetis
185 463819 464094 + NZ_CP035688.1 Vibrio metoecus
186 765522 765797 + NZ_AP014524.1 Vibrio cholerae MS6
187 319406 319654 + NZ_CP058952.1 Chitinibacter fontanus
188 800548 800826 + NZ_CP044069.1 Vibrio vulnificus
189 1588314 1588658 + NC_015554.1 Alteromonas naphthalenivorans
190 1032672 1032929 - NZ_CP046793.1 Vibrio metschnikovii
191 1275538 1275822 + NZ_CP040990.1 Vibrio furnissii
192 571541 571837 + NZ_CP012418.1 Kangiella sediminilitoris
193 1086425 1086691 + NC_010694.1 Erwinia tasmaniensis Et1/99
194 1089401 1089646 + NZ_CP035129.1 Kosakonia cowanii
195 3513624 3513878 - NZ_CP005974.1 Photobacterium gaetbulicola Gung47
196 2827633 2827893 - NZ_CP070624.1 Photobacterium damselae subsp. damselae
197 2800872 2801156 - NZ_CP071325.1 Photobacterium ganghwense
198 1031635 1031910 + NZ_CP012621.1 Zobellella denitrificans
199 2178954 2179199 + NZ_CP065150.1 Vibrio kanaloae
200 2010663 2010938 + NZ_CP014056.2 Grimontia hollisae
201 1194703 1194972 + NC_017554.1 Pantoea ananatis PA13
202 3929200 3929487 + NZ_CP034759.1 Litorilituus sediminis
203 2455680 2455958 - NZ_CP032093.1 Vibrio alfacsensis
204 3850723 3850986 + NZ_CP014136.1 Gibbsiella quercinecans
205 2593003 2593269 - NZ_AP014635.1 Vibrio tritonius
206 1288675 1288938 + NC_022357.1 Sulfuricella denitrificans skB26
207 2587569 2587844 - NZ_CP039700.1 Vibrio cyclitrophicus
208 995132 995404 - NZ_CP039887.1 Neisseria subflava
209 3937332 3937637 + NZ_CP052766.1 Alteromonas pelagimontana
210 2018727 2018993 - NZ_CP033078.1 Vibrio zhugei
211 942522 942851 + NZ_CP010554.1 Rugosibacter aromaticivorans
212 1017294 1017566 - NC_018012.1 Thiocystis violascens DSM 198
213 2482152 2482394 - NC_012691.1 Tolumonas auensis DSM 9187
214 2652463 2652714 - NC_011312.1 Aliivibrio salmonicida LFI1238
215 1678705 1678962 - NZ_AP012273.1 Thiolapillus brandeum
216 2271488 2271751 + NZ_CP035467.1 Methylotuvimicrobium buryatense
217 1310625 1310930 - NC_012969.1 Methylovorus glucosetrophus SIP3-4
218 1231942 1232205 - NZ_AP018558.1 Hydrogenophilus thermoluteolus
219 2494376 2494645 - NZ_CP007445.1 Gilliamella apicola
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP042941.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF03364.22 0.95 208 14 same-strand Polyketide cyclase / dehydrase and lipid transport
2 PF10604.11 0.95 207 14 same-strand Polyketide cyclase / dehydrase and lipid transport
3 PF01025.21 0.76 166 3361 same-strand GrpE
4 PF20143.1 0.78 169 2356.0 opposite-strand ATP-NAD kinase C-terminal domain
5 PF01513.23 0.74 161 2356.0 opposite-strand ATP-NAD kinase N-terminal domain
6 PF02463.21 0.78 171 603 opposite-strand RecF/RecN/SMC N terminal domain
7 PF13476.8 0.76 165 604.0 opposite-strand AAA domain
8 PF04355.15 0.79 172 92 opposite-strand SmpA / OmlA family
9 PF01668.20 0.86 188 604 opposite-strand SmpB protein
++ More..