Result : Q0VML3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | |
| Organism | Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MKSLLLGAIWLYQKVLSPWIGNQCRFYPTCSEYARQAVETHGSLRGSALAAKRLCKCHPWHPGGFDYVPGAVPGAEPDQEQHQCTPLCNHHSEDHSQ |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 16878126 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q0VML3 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2441415 | 2441708 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 2 | 336119 | 336394 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 3 | 3238599 | 3238838 | - | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 4 | 3712424 | 3712696 | + | NC_010645.1 | Bordetella avium 197N |
| 5 | 5834394 | 5834666 | - | NZ_CP016172.1 | Bordetella flabilis |
| 6 | 566159 | 566425 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 7 | 6372224 | 6372484 | - | NZ_CP048832.1 | Janthinobacterium lividum |
| 8 | 3244795 | 3245052 | - | NZ_CP072793.1 | Thiothrix unzii |
| 9 | 3895217 | 3895477 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 10 | 913241 | 913510 | - | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 11 | 155786 | 156088 | - | NC_009931.1 | Acaryochloris marina MBIC11017 |
| 12 | 3919688 | 3920002 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 13 | 393429 | 393743 | + | NZ_CP068285.1 | Ralstonia syzygii subsp. celebesensis |
| 14 | 131942 | 132241 | - | NC_009932.1 | Acaryochloris marina MBIC11017 |
| 15 | 4564699 | 4564983 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 16 | 4514261 | 4514497 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 17 | 80297 | 80536 | - | NZ_LT906467.1 | Corynebacterium imitans |
| 18 | 3628166 | 3628483 | - | NZ_CP011502.1 | Aeromicrobium erythreum |
| 19 | 2220463 | 2220699 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 20 | 859 | 1113 | + | NZ_LT907988.1 | Orrella dioscoreae |
| 21 | 2239154 | 2239417 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 22 | 6094175 | 6094423 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 23 | 2681162 | 2681425 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 24 | 28744 | 29007 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 25 | 2605610 | 2605876 | - | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017754.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.71 | 17 | 12 | same-strand | 60Kd inner membrane protein |
++ More..