Result : Q0TIL5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Regulatory protein AriR |
| NCBI Accession ID | CP000247.1 |
| Organism | Escherichia coli O6:K15:H31 (strain 536 / UPEC) |
| Left | 1239343 |
| Right | 1239609 |
| Strand | + |
| Nucleotide Sequence | ATGCTTGAAGATACTACTATTCATAATGCAATATCTGATAAAGCGTTATCAAGTTACTTTCGTAGTTCAGGTAATTTGTTAGAAGAAGAGTCTGCTGTGTTAGGGCAGGCTGTGACCAATTTAATGCTTTCAGGCGATAATGTTAATAATAAAAATATTATCTTAAGTCTGATACACTCCCTGGAAACAACAAGTGATATTCTCAAAGCTGATGTGATTAGAAAAACACTGGAAATCGTGTTGCGATACACAGCTGATGATATGTAA |
| Sequence | MLEDTTIHNAISDKALSSYFRSSGNLLEEESAVLGQAVTNLMLSGDNVNNKNIILSLIHSLETTSDILKADVIRKTLEIVLRYTADDM |
| Source of smORF | Swiss-Prot |
| Function | Regulates expression of genes involved in acid-resistance and biofilm formation. May be a non-specific DNA-binding protein that binds genes and/or intergenic regions via a geometric recognition (By similarity). {ECO:0000250}. |
| Pubmed ID | 16879640 |
| Domain | CDD:402434 |
| Functional Category | DNA-binding |
| Uniprot ID | Q0TIL5 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1216369 | 1216635 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 499292 | 499558 | - | NZ_CP033744.1 | Citrobacter freundii |
| 3 | 4593096 | 4593362 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 4 | 2135766 | 2136002 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 5 | 3500481 | 3500717 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 6 | 2257687 | 2257965 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 7 | 4429044 | 4429322 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 8 | 1496715 | 1496993 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 9 | 1920190 | 1920468 | - | NC_015968.1 | Enterobacter soli |
| 10 | 2183884 | 2184162 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 11 | 834249 | 834527 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 12 | 66491 | 66757 | - | NZ_CP012265.1 | Cronobacter condimenti 1330 |
| 13 | 1947460 | 1947738 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 14 | 3830892 | 3831158 | + | NZ_CP054254.1 | Klebsiella variicola |
| 15 | 1667745 | 1668011 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 16 | 1894010 | 1894288 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 17 | 578275 | 578553 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 18 | 1973021 | 1973299 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 19 | 4221913 | 4222179 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 20 | 1968033 | 1968254 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 21 | 3609107 | 3609373 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 22 | 1177998 | 1178276 | - | NZ_CP017279.1 | Enterobacter ludwigii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033744.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13411.8 | 0.95 | 21 | 2345 | opposite-strand | MerR HTH family regulatory protein |
| 2 | PF00376.25 | 0.95 | 21 | 2345 | opposite-strand | MerR family regulatory protein |
| 3 | PF12728.9 | 0.91 | 20 | 2345.0 | opposite-strand | Helix-turn-helix domain |
| 4 | PF00563.22 | 0.95 | 21 | 935 | opposite-strand | EAL domain |
| 5 | PF04940.14 | 0.95 | 21 | 935 | opposite-strand | Sensors of blue-light using FAD |
| 6 | PF00196.21 | 0.64 | 14 | 2844.5 | both-strands | Bacterial regulatory proteins, luxR family |
++ More..