Result : Q0TFW4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0387 membrane protein YohO |
| NCBI Accession ID | CP000247.1 |
| Organism | Escherichia coli O6:K15:H31 (strain 536 / UPEC) |
| Left | 2256534 |
| Right | 2256641 |
| Strand | + |
| Nucleotide Sequence | ATGCGCATAGCTAAAATTGGGGTCATCGCCCTGTTCCTGTTTATGGCGTTAGGCGGAATTGGTGGCGTCATGCTCGCAGGTTATACCTTTATTTTGCGTGCTGGCTGA |
| Sequence | MRIAKIGVIALFLFMALGGIGGVMLAGYTFILRAG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of PRK13681. Profile Description: protein YohO. |
| Pubmed ID | 16879640 |
| Domain | CDD:184238 |
| Functional Category | Others |
| Uniprot ID | Q0TFW4 |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 94
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2944664 | 2944771 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2219912 | 2220019 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 2215657 | 2215764 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 2238452 | 2238559 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1214711 | 1214818 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 1639988 | 1640095 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 2762685 | 2762792 | + | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 2257157 | 2257264 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 250832 | 250939 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 641710 | 641817 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 2398420 | 2398527 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 4454246 | 4454353 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 13 | 924947 | 925054 | + | NZ_CP033744.1 | Citrobacter freundii |
| 14 | 4136710 | 4136817 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 15 | 320948 | 321055 | - | NZ_CP038469.1 | Citrobacter tructae |
| 16 | 2352118 | 2352225 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 17 | 1920953 | 1921066 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 18 | 1854562 | 1854675 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 19 | 1719128 | 1719241 | - | NZ_CP050508.1 | Raoultella terrigena |
| 20 | 1654151 | 1654264 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 21 | 35502 | 35615 | + | NZ_CP026047.1 | Raoultella planticola |
| 22 | 1644368 | 1644481 | - | NZ_CP041247.1 | Raoultella electrica |
| 23 | 1572006 | 1572119 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 24 | 2251042 | 2251155 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 25 | 1313649 | 1313753 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 26 | 912842 | 912955 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 27 | 1355419 | 1355523 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 28 | 4568560 | 4568673 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 29 | 1662075 | 1662188 | - | NZ_CP054254.1 | Klebsiella variicola |
| 30 | 3644060 | 3644173 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 31 | 1608729 | 1608842 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 32 | 2524365 | 2524469 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 33 | 1570826 | 1570930 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 34 | 1593242 | 1593355 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 35 | 4841312 | 4841425 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 36 | 1656197 | 1656310 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 37 | 377166 | 377279 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 38 | 1459365 | 1459478 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 39 | 3179028 | 3179141 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 40 | 4785476 | 4785589 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 41 | 3360696 | 3360809 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 42 | 1817300 | 1817413 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 43 | 2390365 | 2390478 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 44 | 3251863 | 3251976 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 45 | 3088664 | 3088777 | + | NC_015968.1 | Enterobacter soli |
| 46 | 3139939 | 3140052 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 47 | 882678 | 882791 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 48 | 1578125 | 1578238 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 49 | 3414763 | 3414876 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 50 | 4149246 | 4149359 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 51 | 3089242 | 3089355 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 52 | 3112185 | 3112298 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 53 | 1900739 | 1900852 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 54 | 1305351 | 1305458 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 55 | 3047250 | 3047363 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 56 | 2837898 | 2838008 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 57 | 1930288 | 1930395 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 58 | 2849612 | 2849719 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 59 | 1975048 | 1975155 | - | NZ_CP025799.1 | Dickeya zeae |
| 60 | 2506277 | 2506384 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 61 | 1311767 | 1311877 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 62 | 590964 | 591074 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 63 | 814756 | 814863 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 64 | 2935382 | 2935492 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 65 | 1115340 | 1115450 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 66 | 2811548 | 2811658 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 67 | 1978235 | 1978342 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 68 | 4151245 | 4151352 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 69 | 1435236 | 1435343 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 70 | 3470639 | 3470746 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 71 | 2307623 | 2307730 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 72 | 678789 | 678896 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 73 | 3592545 | 3592652 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 74 | 941932 | 942039 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 75 | 1943891 | 1943998 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 76 | 1888211 | 1888318 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 77 | 3236464 | 3236574 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 78 | 3070794 | 3070901 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 79 | 1960656 | 1960763 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 80 | 2936632 | 2936739 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 81 | 1084733 | 1084840 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 82 | 1717142 | 1717249 | - | NZ_LT615367.1 | Dickeya aquatica |
| 83 | 4650360 | 4650467 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 84 | 3420488 | 3420595 | + | NZ_CP023525.1 | Cedecea neteri |
| 85 | 3041205 | 3041312 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 86 | 1732913 | 1733020 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 87 | 3198839 | 3198946 | + | NZ_LR134201.1 | Cedecea lapagei |
| 88 | 146720 | 146827 | + | NZ_CP019706.1 | Pantoea alhagi |
| 89 | 706608 | 706715 | - | NZ_CP028271.1 | Mixta intestinalis |
| 90 | 2207362 | 2207469 | + | NZ_CP065534.1 | Lonsdalea populi |
| 91 | 1467979 | 1468086 | - | NZ_CP061511.1 | Mixta calida |
| 92 | 1548298 | 1548405 | - | NZ_CP026377.1 | Mixta gaviniae |
| 93 | 2818099 | 2818206 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 94 | 3462470 | 3462577 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 95 | 3258111 | 3258224 | + | NZ_LS483470.1 | Leminorella richardii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.72 | 68 | 804.0 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF00005.29 | 0.78 | 73 | 696.0 | opposite-strand | ABC transporter |
| 3 | PF04069.14 | 0.7 | 66 | 2809 | opposite-strand | Substrate binding domain of ABC-type glycine betaine transport system |
| 4 | PF00933.23 | 0.83 | 78 | 3872 | opposite-strand | Glycosyl hydrolase family 3 N terminal domain |
| 5 | PF01915.24 | 0.83 | 78 | 3872 | opposite-strand | Glycosyl hydrolase family 3 C-terminal domain |
| 6 | PF14310.8 | 0.83 | 78 | 3872 | opposite-strand | Fibronectin type III-like domain |
| 7 | PF13411.8 | 0.62 | 58 | 60.0 | same-strand | MerR HTH family regulatory protein |
| 8 | PF00376.25 | 0.62 | 58 | 60.0 | same-strand | MerR family regulatory protein |
++ More..