Result : Q0SU12
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein CPR_1073 |
| NCBI Accession ID | CP000312.1 |
| Organism | Clostridium perfringens (strain SM101 / Type A) |
| Left | 1220911 |
| Right | 1221090 |
| Strand | + |
| Nucleotide Sequence | ATGAATATAGATGAATTAACAAAAAGAATAAATGAATTACACAAAAAGCACAAAGAAGAAGGTTTATCAGAGGATGAACATAAAGAAAGAGAAGAACTTAGAAAAGAATATATAAATAGATTCAAAAGCAATTTAAGAGAACAGTTAAAAGGAATTGAGCCGAAAAATAAGAAAAATTAA |
| Sequence | MNIDELTKRINELHKKHKEEGLSEDEHKEREELRKEYINRFKSNLREQLKGIEPKNKKN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 16825665 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q0SU12 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1435556 | 1435735 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 2 | 1875554 | 1875742 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 3 | 2713104 | 2713274 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 4 | 1832726 | 1832914 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 5 | 3419502 | 3419675 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 6 | 3968488 | 3968661 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 7 | 2575963 | 2576157 | - | NZ_CP040924.1 | Clostridium thermarum |
| 8 | 1871759 | 1871935 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 9 | 2440979 | 2441164 | - | NZ_CP014176.1 | Clostridium argentinense |
| 10 | 2059121 | 2059294 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 11 | 5882759 | 5882932 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 12 | 5885851 | 5886024 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 13 | 1059894 | 1060064 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 14 | 4477741 | 4477914 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 15 | 2393326 | 2393508 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 16 | 3639371 | 3639574 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 17 | 5348664 | 5348858 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 18 | 3351550 | 3351759 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 19 | 2931911 | 2932099 | + | NZ_CP023671.1 | Clostridium septicum |
| 20 | 306320 | 306502 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 21 | 4020374 | 4020559 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 22 | 641943 | 642134 | + | NZ_CP016786.1 | Clostridium isatidis |
| 23 | 2941308 | 2941496 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 24 | 1800998 | 1801183 | - | NZ_CP033433.1 | Cohnella candidum |
| 25 | 1404721 | 1404912 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 26 | 3493462 | 3493647 | + | NZ_AP019400.1 | Cohnella abietis |
| 27 | 2047300 | 2047449 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 28 | 379104 | 379277 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 29 | 857674 | 857844 | + | NZ_CP014204.2 | Clostridium baratii |
| 30 | 4081658 | 4081843 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
++ More..