Result : Q0SSK1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein CPR_1590 |
| NCBI Accession ID | CP000312.1 |
| Organism | Clostridium perfringens (strain SM101 / Type A) |
| Left | 1778084 |
| Right | 1778341 |
| Strand | - |
| Nucleotide Sequence | ATGGAAGAAAAACAAATAATGGCTTTTAGAGATGAAGAAGGAAATAAAGTTGAATTTGAGGTTGTTGCTAAAATATATTTAGGAGAAAAGAACAAAAAAGAATATATAGTTCTTTCACCAGTAGAAGGTAACGGAGATGAAGCTGATGACTTTGTTTTTAGAGTTGATAAAGTAAATGATTCAGTTGAATATAACTTAGTTGAAGATGATGAAGAGTTTAGATTAGTAAAAAAAGAATATAAGAAATTATTATACTAA |
| Sequence | MEEKQIMAFRDEEGNKVEFEVVAKIYLGEKNKKEYIVLSPVEGNGDEADDFVFRVDKVNDSVEYNLVEDDEEFRLVKKEYKKLLY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | 16825665 |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | Q0SSK1 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2103326 | 2103583 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 2 | 2376573 | 2376827 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 3 | 856025 | 856270 | + | NZ_CP014204.2 | Clostridium baratii |
| 4 | 4790869 | 4791114 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 5 | 1877048 | 1877275 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 6 | 2565747 | 2565992 | - | NZ_CP030775.1 | Clostridium butyricum |
| 7 | 640733 | 640957 | + | NZ_CP016786.1 | Clostridium isatidis |
| 8 | 3386577 | 3386822 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 9 | 2930351 | 2930578 | + | NZ_CP023671.1 | Clostridium septicum |
| 10 | 1607559 | 1607804 | + | NZ_CP043998.1 | Clostridium diolis |
| 11 | 2711415 | 2711684 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 12 | 2577512 | 2577760 | - | NZ_CP040924.1 | Clostridium thermarum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017253.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02127.17 | 0.75 | 9 | 2559 | same-strand | Aminopeptidase I zinc metalloprotease (M18) |
| 2 | PF07475.14 | 0.92 | 11 | 1584 | same-strand | HPr Serine kinase C-terminal domain |
| 3 | PF02603.18 | 0.92 | 11 | 1584 | same-strand | HPr Serine kinase N terminus |
++ More..