Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | CP000312.1 |
Organism | Clostridium perfringens (strain SM101 / Type A) |
Left | 2144837 |
Right | 2145106 |
Strand | + |
Nucleotide Sequence | GTGATTAGAAAAGAATTTCTAGTAAGTGGTAGAGTCCAAGGAGTAGGTTTCAGATTCTTTTGTAAGTATCAGGCAAGCTTATTATCTTTAACTGGTTATGCTGAAAATTTAGATGATGGTCAAGTACTTATAGAGGTGCAAGGTGATGAATCATCAATAAGAAAATTTAAAACTAAAATTTTAAATGGTAATGGTTTTTCAAGAGTTATTTCTATAGATGAGAAGGATTTAACTGTTGATACCCGCGAAAAAAGATTTTCTACATACTAA |
Sequence | MIRKEFLVSGRVQGVGFRFFCKYQASLLSLTGYAENLDDGQVLIEVQGDESSIRKFKTKILNGNGFSRVISIDEKDLTVDTREKRFSTY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 16825665 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q0SRK7 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2475428 | 2475697 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
2 | 4902597 | 4902869 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
3 | 1262246 | 1262518 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
4 | 1401256 | 1401525 | - | NZ_LN824141.1 | Defluviitoga tunisiensis |
5 | 4826730 | 4827002 | + | NZ_CP043998.1 | Clostridium diolis |
6 | 953892 | 954164 | - | NZ_CP017253.2 | Clostridium taeniosporum |
7 | 2355606 | 2355836 | - | NZ_CP013019.1 | Clostridium pasteurianum |
8 | 272585 | 272854 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00334.21 | 0.62 | 5 | 185 | opposite-strand | Nucleoside diphosphate kinase |