Result : Q0SR44
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP000312.1 |
| Organism | Clostridium perfringens (strain SM101 / Type A) |
| Left | 2330984 |
| Right | 2331256 |
| Strand | - |
| Nucleotide Sequence | ATGAGTTTTTTAAATGTTTTTTCTAGTAGACCTACGCCGAAACAAGTTGCTAAGGATAGATTAAAGGTTATTTTAATTCATGATAGAGGGGAACTATCAGATGAAGTTTTGGATAAAATAAGACTTGAAATATTAGATGTACTTTCTAAATATGTAGAGATTGAAAATGAGGATGTTGACATAACTGTTACAAAGTCAAATGCAATAGAAGGGGAATCACCATCTTTAGTAGCAAATATACCAATAAAAAATATAAAGGGTAAAGCTAGATAA |
| Sequence | MSFLNVFSSRPTPKQVAKDRLKVILIHDRGELSDEVLDKIRLEILDVLSKYVEIENEDVDITVTKSNAIEGESPSLVANIPIKNIKGKAR |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 16825665 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q0SR44 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2662014 | 2662286 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 2 | 2317426 | 2317692 | + | NZ_CP023671.1 | Clostridium septicum |
| 3 | 2358233 | 2358499 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 4 | 648202 | 648468 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 5 | 2360309 | 2360569 | - | NZ_CP016786.1 | Clostridium isatidis |
| 6 | 645058 | 645327 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 7 | 605784 | 606056 | + | NZ_CP014204.2 | Clostridium baratii |
| 8 | 600931 | 601200 | + | NZ_CP043998.1 | Clostridium diolis |
| 9 | 5796952 | 5797221 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 10 | 545599 | 545865 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 11 | 3195321 | 3195587 | - | NZ_CP030775.1 | Clostridium butyricum |
| 12 | 1396780 | 1397052 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 13 | 1661107 | 1661370 | - | NZ_HG917868.1 | Clostridium bornimense |
| 14 | 1009870 | 1010133 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 15 | 3632813 | 3633082 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 16 | 2514256 | 2514525 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 17 | 2545931 | 2546203 | - | NZ_CP040924.1 | Clostridium thermarum |
| 18 | 3057676 | 3057942 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 19 | 808058 | 808324 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 20 | 3158409 | 3158672 | - | NZ_CP028842.1 | Clostridium botulinum |
| 21 | 3391736 | 3391999 | - | NZ_CP011663.1 | Clostridium sporogenes |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008261.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF19864.1 | 0.67 | 14 | 3331.0 | same-strand | Radical SAM proteins, N-terminal |
| 2 | PF04055.23 | 0.67 | 14 | 3331.0 | same-strand | Radical SAM superfamily |
| 3 | PF01098.21 | 0.95 | 20 | 135.0 | same-strand | Cell cycle protein |
| 4 | PF13614.8 | 1.0 | 21 | 15 | same-strand | AAA domain |
| 5 | PF01656.25 | 1.0 | 21 | 15 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 6 | PF10609.11 | 0.71 | 15 | 15 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 7 | PF03775.18 | 1.0 | 21 | 833 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 8 | PF03717.17 | 0.9 | 19 | 1841 | same-strand | Penicillin-binding Protein dimerisation domain |
| 9 | PF00905.24 | 0.71 | 15 | 1841 | same-strand | Penicillin binding protein transpeptidase domain |
| 10 | PF04093.14 | 0.81 | 17 | 4636 | same-strand | rod shape-determining protein MreD |
| 11 | PF04085.16 | 0.67 | 14 | 5106.0 | same-strand | rod shape-determining protein MreC |
++ More..