Result : A6VP52
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein Asuc_1390 |
| NCBI Accession ID | CP000746.1 |
| Organism | Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / 130Z) |
| Left | 1544061 |
| Right | 1544330 |
| Strand | + |
| Nucleotide Sequence | ATGTTGTGCGCGATTTATAAAAGTAAAAAGAAAGACGGAATGTATTTATATATAGAAAAACGTGATGATTTTTCCGTTTTACCGGATTCATTACGTGAAGCTTTCGGAATACCGGTATTCGTTATGTTGTTTAATTTGGTCGGTAAAAAAACACTTATCAATACGGACAACCGGGAAGTCATGGAACAAATTAAACAAAACGGTTTTTACCTGCAAATGCCCAAAAAAGATGATTGGTTATTTACCATCGAAAAGTCATGTGATCTGTAA |
| Sequence | MLCAIYKSKKKDGMYLYIEKRDDFSVLPDSLREAFGIPVFVMLFNLVGKKTLINTDNREVMEQIKQNGFYLQMPKKDDWLFTIEKSCDL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | 21118570 |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | A6VP52 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1265395 | 1265670 | - | NZ_LR134167.1 | Avibacterium volantium |
| 2 | 1267062 | 1267313 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 3 | 686416 | 686667 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 4 | 1216939 | 1217217 | - | NZ_CP018804.1 | Histophilus somni |
| 5 | 1838462 | 1838713 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 6 | 17798 | 18049 | - | NZ_CP028926.1 | Pasteurella multocida |
| 7 | 663066 | 663362 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 8 | 1368057 | 1368323 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 9 | 451193 | 451459 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 10 | 1220883 | 1221176 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 11 | 1780468 | 1780734 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 12 | 187583 | 187861 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 13 | 1547166 | 1547432 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 14 | 1460161 | 1460427 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 15 | 923500 | 923790 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 16 | 1504440 | 1504691 | + | NZ_CP061280.1 | Mannheimia bovis |
| 17 | 1230371 | 1230661 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 18 | 1509005 | 1509232 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 19 | 1141731 | 1141970 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 20 | 1478578 | 1478817 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 21 | 1318811 | 1319050 | + | NZ_CP046531.1 | Mannheimia ovis |
| 22 | 704380 | 704619 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 23 | 728096 | 728335 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 24 | 1778659 | 1778895 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 25 | 834278 | 834505 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 26 | 652621 | 652884 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 27 | 852387 | 852665 | - | NZ_LS483250.1 | Moritella yayanosii |
| 28 | 784421 | 784699 | + | NZ_CP011040.1 | Pseudoalteromonas spongiae UST010723-006 |
| 29 | 2783494 | 2783784 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 30 | 1743351 | 1743629 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 31 | 1500041 | 1500319 | + | NZ_CP040990.1 | Vibrio furnissii |
| 32 | 4231107 | 4231376 | - | NZ_CP065640.1 | Serratia rubidaea |
| 33 | 1341711 | 1341992 | + | NZ_CP046268.1 | Vibrio spartinae |
| 34 | 1822543 | 1822815 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 35 | 2003076 | 2003345 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 36 | 2167050 | 2167325 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 37 | 66866 | 67138 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 38 | 2389418 | 2389699 | - | NZ_AP014635.1 | Vibrio tritonius |
| 39 | 1521106 | 1521381 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 40 | 1457747 | 1458025 | + | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 41 | 1944934 | 1945203 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 42 | 3444926 | 3445198 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 43 | 2546936 | 2547208 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 44 | 217852 | 218124 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 45 | 4037419 | 4037694 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 46 | 2099168 | 2099440 | + | NZ_CP046293.1 | Yersinia intermedia |
| 47 | 1945146 | 1945421 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 48 | 887404 | 887679 | + | NZ_AP018689.1 | Vibrio aphrogenes |
++ More..