Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L30 |
NCBI Accession ID | CP002933.1 |
Organism | Borrelia afzelii (strain PKo) |
Left | 507194 |
Right | 507415 |
Strand | + |
Nucleotide Sequence | ATGGAAAAGAATAGGGAAATTATTTCTAAAAACAATATTAATGTGGAAGTTTTTCTTATAAGAAGTCTTATTGGAAAATTAAATAAAAAGGTCAAAGTTTTAAAAGCATTGGGTTTAAATAAAATAGGTGATAAAAAGGTTCATTTTTTAAATCAATCTATTAAAGGTATGCTTAACGAGACTATTAATATGATTTTATTAAGCGAGGTAAGTAATGTTTAG |
Sequence | MEKNREIISKNNINVEVFLIRSLIGKLNKKVKVLKALGLNKIGDKKVHFLNQSIKGMLNETINMILLSEVSNV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
Pubmed ID | 16914037 22123755 |
Domain | CDD:412218 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q0SN11 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 507724 | 507945 | + | NZ_CP028861.1 | Borreliella garinii |
2 | 506000 | 506221 | + | NZ_CP015796.1 | Borreliella mayonii |
3 | 503568 | 503783 | + | NC_015921.1 | Borreliella bissettii DN127 |
4 | 503123 | 503344 | + | NZ_CP044535.1 | Borrelia maritima |
5 | 501193 | 501414 | + | NZ_CP013704.1 | Borrelia anserina Es |
6 | 524577 | 524798 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
7 | 400600 | 400824 | - | NZ_CP024333.1 | Borrelia miyamotoi |
8 | 510089 | 510310 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
9 | 507388 | 507609 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
10 | 507515 | 507736 | + | NC_008710.1 | Borrelia turicatae 91E135 |
11 | 524645 | 524866 | + | NC_011244.1 | Borrelia recurrentis A1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00253.23 | 1.0 | 11 | 1947 | same-strand | Ribosomal protein S14p/S29e |
2 | PF00410.21 | 1.0 | 11 | 1539 | same-strand | Ribosomal protein S8 |
3 | PF00347.25 | 1.0 | 11 | 978 | same-strand | Ribosomal protein L6 |
4 | PF00861.24 | 1.0 | 11 | 601 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
5 | PF03719.17 | 1.0 | 11 | 94 | same-strand | Ribosomal protein S5, C-terminal domain |
6 | PF00333.22 | 1.0 | 11 | 94 | same-strand | Ribosomal protein S5, N-terminal domain |
7 | PF00828.21 | 1.0 | 11 | -7 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
8 | PF00344.22 | 1.0 | 11 | 443 | same-strand | SecY |
9 | PF00444.20 | 0.91 | 10 | 1757.0 | same-strand | Ribosomal protein L36 |
10 | PF00416.24 | 1.0 | 11 | 1880 | same-strand | Ribosomal protein S13/S18 |
11 | PF00411.21 | 1.0 | 11 | 2288 | same-strand | Ribosomal protein S11 |