| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 (EC 3.1.-.-) |
| NCBI Accession ID | CT573213.2 |
| Organism | Frankia alni (strain ACN14a) |
| Left | 6036259 |
| Right | 6036522 |
| Strand | + |
| Nucleotide Sequence | ATGTTCGTCGTCCTCGTCTACGACACCGCAGCCGAGCGCAATCCGAACGCCCTGCGCACCTGCCGCAAGTACCTGCACTGGGTCCAACGCAGCGTCTTCGAGGGAGAGCTGTCCGCCGCCCAGTACCGCGCCCTGATGACCACGCTGCGCGACCAGCTCGACCTCACCTACGACAGCATCCGCGTCTACCGCACCCGCTCCCCCGCCCTCGTCGAAACCGAATGGCTAGGCGTCCCCCTGGGCAACCAGGACTCCGTCCTCTAG |
| Sequence | MFVVLVYDTAAERNPNALRTCRKYLHWVQRSVFEGELSAAQYRALMTTLRDQLDLTYDSIRVYRTRSPALVETEWLGVPLGNQDSVL |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
| Pubmed ID | 17151343 |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | Q0RE94 |
| ORF Length (Amino Acid) | 87 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6036259 | 6036522 | + | NC_008278.1 | Frankia alni ACN14a |
| 2 | 1118120 | 1118383 | - | NC_009380.1 | Salinispora tropica CNB-440 |
| 3 | 4674797 | 4675060 | - | NZ_CP065253.1 | Streptomyces clavuligerus |
| 4 | 1043927 | 1044190 | + | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 5 | 2395094 | 2395357 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 6 | 1124939 | 1125205 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01930.19 | 1.0 | 6 | 987.0 | same-strand | Domain of unknown function DUF83 |
| 2 | PF01867.18 | 1.0 | 6 | 5.0 | same-strand | CRISPR associated protein Cas1 |
| 3 | PF00270.31 | 0.83 | 5 | 1497 | same-strand | DEAD/DEAH box helicase |