Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | |
Organism | Frankia alni (strain ACN14a) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MPGPTVVRFTARVVGRVQGVGFRDYVRTRGRRLGLVGTATNMPDGAVVVIAEGGAPACQNLARLLVTGHTPGWTDRVEVVWQRAQGDLADFRRK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 17151343 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q0RDN6 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 6285567 | 6285851 | - | NC_008278.1 | Frankia alni ACN14a |
2 | 4300473 | 4300742 | - | NC_007777.1 | Frankia casuarinae |
3 | 1334222 | 1334458 | + | NC_014666.1 | Frankia inefficax |
4 | 2050817 | 2051065 | + | NZ_LT906450.1 | Rhodococcus rhodochrous |
5 | 2457355 | 2457603 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
6 | 1568405 | 1568698 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
7 | 981625 | 981891 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
8 | 2105936 | 2106229 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
9 | 2102319 | 2102567 | + | NZ_CP029146.1 | Rhodococcus ruber |
10 | 8884601 | 8884849 | + | NZ_CP022088.2 | Nocardia brasiliensis |
11 | 8807955 | 8808191 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
12 | 1993818 | 1994066 | - | NZ_CP015449.1 | Dietzia lutea |
13 | 4927153 | 4927389 | - | NZ_AP022606.1 | Mycobacterium branderi |
14 | 3660879 | 3661115 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
15 | 2073925 | 2074161 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
16 | 3955174 | 3955434 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
17 | 3255275 | 3255544 | - | NC_014165.1 | Thermobispora bispora DSM 43833 |
18 | 2511391 | 2511639 | + | NZ_AP023355.1 | Actinocatenispora thailandica |
19 | 4961179 | 4961415 | - | NZ_CP015235.1 | Rhodococcus fascians D188 |
20 | 7903650 | 7903916 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
21 | 1693555 | 1693821 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
22 | 2209595 | 2209843 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
23 | 4819067 | 4819315 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
24 | 2203683 | 2203949 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
25 | 342868 | 343116 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
26 | 1520952 | 1521218 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
27 | 3319113 | 3319349 | + | NZ_CP043474.1 | Mycobacterium grossiae |
28 | 1094874 | 1095155 | - | NZ_LS483468.1 | Rhodococcus coprophilus |
29 | 9542368 | 9542616 | - | NZ_CP034550.1 | Saccharothrix syringae |
30 | 3492677 | 3492958 | - | NZ_CP027793.1 | Rhodococcus hoagii |
31 | 1857698 | 1857931 | + | NZ_CP041694.1 | Cellulosimicrobium cellulans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00448.24 | 0.68 | 21 | 4550.0 | same-strand | SRP54-type protein, GTPase domain |
2 | PF02881.21 | 0.68 | 21 | 4550.0 | same-strand | SRP54-type protein, helical bundle domain |
3 | PF02463.21 | 0.87 | 27 | 142 | same-strand | RecF/RecN/SMC N terminal domain |
4 | PF06470.15 | 0.9 | 28 | 207.5 | same-strand | SMC proteins Flexible Hinge Domain |
5 | PF13476.8 | 0.94 | 29 | 258 | same-strand | AAA domain |
6 | PF01149.26 | 0.65 | 20 | 1255.5 | same-strand | Formamidopyrimidine-DNA glycosylase N-terminal domain |
7 | PF06831.16 | 0.71 | 22 | 1308.5 | same-strand | Formamidopyrimidine-DNA glycosylase H2TH domain |
8 | PF06827.16 | 0.71 | 22 | 1308.5 | same-strand | Zinc finger found in FPG and IleRS |
9 | PF14622.8 | 0.61 | 19 | 2110 | same-strand | Ribonuclease-III-like |
10 | PF00636.28 | 0.61 | 19 | 2110 | same-strand | Ribonuclease III domain |
11 | PF00035.28 | 0.61 | 19 | 2110 | same-strand | Double-stranded RNA binding motif |