Result : Q0K4W7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0213 protein H16_B0156 |
| NCBI Accession ID | AM260480.1 |
| Organism | Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) |
| Left | 180192 |
| Right | 180470 |
| Strand | + |
| Nucleotide Sequence | ATGTCGGCTGACAGCGCCTGGTACCTCTATCTGCTCGAATGCACCGGCGATTCCATCTACACCGGGATCACGACCGATGTTGCCCGCCGCTTCGCCGAGCATCTGTCCGGAAAAGGCGCTAAATATACGCGATCGCGCAAGCCCATACGCGTTTTGGGCCAATTGCGCTTCGACACGAAATCCGAAGCGTTGAAAGCGGAAATCGAGATCAAGCGCTTGAGTTCGACACAGAAGCGCGCATTTTGCGCGCAACTGCCAGCAACCGAGCCGGCCCGGTAG |
| Sequence | MSADSAWYLYLLECTGDSIYTGITTDVARRFAEHLSGKGAKYTRSRKPIRVLGQLRFDTKSEALKAEIEIKRLSSTQKRAFCAQLPATEPAR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
| Pubmed ID | 16964242 |
| Domain | CDD:417687 |
| Functional Category | Others |
| Uniprot ID | Q0K4W7 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 180194 | 180472 | + | NZ_CP039288.1 | Cupriavidus necator H16 |
| 2 | 1903970 | 1904239 | + | NZ_CP032518.1 | Cupriavidus oxalaticus |
| 3 | 209342 | 209629 | + | NZ_CP017755.1 | Cupriavidus malaysiensis |
| 4 | 3048182 | 3048484 | - | NZ_CP062804.1 | Cupriavidus basilensis |
| 5 | 1784506 | 1784757 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 6 | 2304232 | 2304480 | - | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 7 | 4355983 | 4356261 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 8 | 2339205 | 2339507 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 9 | 1000997 | 1001314 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 10 | 4265200 | 4265493 | + | NZ_CP023465.1 | Lysobacter capsici |
| 11 | 2991459 | 2991728 | + | NZ_CP046603.1 | Lysobacter soli |
| 12 | 2770696 | 2770938 | + | NZ_CP029843.1 | Lysobacter maris |
| 13 | 1256906 | 1257235 | - | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 14 | 2191406 | 2191699 | + | NC_021287.1 | Caballeronia insecticola |
| 15 | 1728488 | 1728814 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 16 | 4393403 | 4393660 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
| 17 | 3066199 | 3066525 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 18 | 2808946 | 2809194 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 19 | 1347289 | 1347567 | - | NZ_CP039731.1 | Aquitalea aquatilis |
| 20 | 3469772 | 3470050 | + | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 21 | 2384865 | 2385131 | + | NZ_CP064781.1 | Azospira restricta |
| 22 | 3631659 | 3631892 | + | NZ_CP037953.1 | Permianibacter aggregans |
| 23 | 939888 | 940157 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 24 | 4062085 | 4062414 | - | NZ_CP023559.1 | Salinicola tamaricis |
| 25 | 602926 | 603171 | - | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 26 | 2256681 | 2256911 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 27 | 1978415 | 1978660 | - | NZ_CP029495.1 | Chromobacterium phragmitis |
| 28 | 1844164 | 1844439 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 29 | 153577 | 153894 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 30 | 1618899 | 1619159 | - | NZ_CP058334.1 | Natronomonas halophila |
| 31 | 43721 | 43993 | + | NZ_CP059540.1 | Planococcus maritimus |
| 32 | 3041399 | 3041662 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 33 | 2072827 | 2073051 | + | NZ_CP038631.1 | Halobacterium salinarum |
| 34 | 1495078 | 1495320 | + | NC_012924.1 | Streptococcus suis SC84 |
| 35 | 46365 | 46634 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 36 | 2638103 | 2638372 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 37 | 113505 | 113756 | + | NZ_CP034145.1 | Haloplanus aerogenes |
| 38 | 1279059 | 1279283 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 39 | 2524864 | 2525124 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 40 | 34773 | 35036 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 41 | 2372732 | 2373022 | - | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 42 | 1235608 | 1235856 | - | NZ_CP045488.1 | Natronorubrum aibiense |
| 43 | 1889406 | 1889630 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
++ More..