Result : Q0IDA2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000435.1 |
| Organism | Synechococcus sp. (strain CC9311) |
| Left | 345486 |
| Right | 345779 |
| Strand | - |
| Nucleotide Sequence | ATGAGCAAGATCACCGCCGACGACGTTCGCAAGGTGGCCAAACTTGCCCGCCTAGATCTACCTGAAGACACCATCGCTACCTATACAGGGCAGCTTGAGCGAATCCTCGATTATGTGGACCAACTTCAAGCGGTGGACACCGAAGGGGTTCCACCCACAACACGTGCTGTAGAAGTGGTCAATGCCACGCGTGAAGACTCTGTTGTGGCCACAGATGTGCGCCAAGAGCTTTTAGATCAGGCCCCCCAACGTGAAGGAGATTTCTTCCGCGTTCCTAAAATCCTCGCGGATTAA |
| Sequence | MSKITADDVRKVAKLARLDLPEDTIATYTGQLERILDYVDQLQAVDTEGVPPTTRAVEVVNATREDSVVATDVRQELLDQAPQREGDFFRVPKILAD |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 16938853 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q0IDA2 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1841500 | 1841793 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 260894 | 261187 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 3 | 1469369 | 1469623 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 4 | 1591822 | 1592076 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 5 | 4429784 | 4430035 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 6 | 1397995 | 1398249 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 7 | 3488544 | 3488813 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 8 | 5199679 | 5199942 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 9 | 3473123 | 3473407 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 10 | 3072071 | 3072361 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 11 | 4432522 | 4432764 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 12 | 4025855 | 4026142 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 13 | 4732470 | 4732709 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 14 | 760639 | 760935 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 15 | 6157013 | 6157252 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 16 | 3669894 | 3670133 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 17 | 2521879 | 2522169 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 18 | 470004 | 470288 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018202.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00515.30 | 0.72 | 13 | 101.5 | same-strand | Tetratricopeptide repeat |
| 2 | PF07719.19 | 0.72 | 13 | 101.5 | same-strand | Tetratricopeptide repeat |
| 3 | PF13424.8 | 0.72 | 13 | 101.5 | same-strand | Tetratricopeptide repeat |
| 4 | PF13432.8 | 0.67 | 12 | 91 | same-strand | Tetratricopeptide repeat |
| 5 | PF13414.8 | 0.72 | 13 | 101.5 | same-strand | TPR repeat |
| 6 | PF13181.8 | 0.67 | 12 | 91 | same-strand | Tetratricopeptide repeat |
++ More..