| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | CP000435.1 |
| Organism | Synechococcus sp. (strain CC9311) |
| Left | 522042 |
| Right | 522326 |
| Strand | - |
| Nucleotide Sequence | ATGACTCTCCGTGACCTTGTCGACAAATTGCTTGGGCGTCAACCAGCGAGCGCCAGTACTGCCAGAGACAGGCTTCAACTTGTTCTGGCTCACGACCGCAGTGACCTAAGCCCTGAGCTTCTCGACCAAATGCGTCGTGAAATTTTTGAAGTGGTGGCTAAATACGTCGATATCGACCTAGAGGAAGGGGATGTAAGCCTGGAAACCGAAGATCGTGTAACGGCCTTAGTTGCCAACTTGCCGTTTCGTCGACCAATTACTTCAGCACCTCCCAAATCTGACTAA |
| Sequence | MTLRDLVDKLLGRQPASASTARDRLQLVLAHDRSDLSPELLDQMRREIFEVVAKYVDIDLEEGDVSLETEDRVTALVANLPFRRPITSAPPKSD |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 16938853 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q0ICQ3 |
| ORF Length (Amino Acid) | 94 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 345276 | 345596 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 3559502 | 3559789 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 3 | 132206 | 132484 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 4 | 1972105 | 1972380 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 3440397 | 3440681 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 6 | 680735 | 680995 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 7 | 4596955 | 4597245 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 8 | 2743351 | 2743653 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 9 | 1111146 | 1111448 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 10 | 3554177 | 3554422 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 11 | 441010 | 441282 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10609.11 | 0.91 | 10 | 37.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 2 | PF01656.25 | 1.0 | 11 | 37 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF13614.8 | 1.0 | 11 | 37 | same-strand | AAA domain |
| 4 | PF06564.14 | 0.73 | 8 | 37.0 | same-strand | Cellulose biosynthesis protein BcsQ |
| 5 | PF03775.18 | 1.0 | 11 | 960 | same-strand | Septum formation inhibitor MinC, C-terminal domain |