ProsmORF-pred
Result : Q0I867
Protein Information
Information Type Description
Protein name Photosystem I reaction center subunit IX
NCBI Accession ID CP000435.1
Organism Synechococcus sp. (strain CC9311)
Left 1907817
Right 1907936
Strand -
Nucleotide Sequence ATGAAGAAATTTCTTACAACTGCACCTGTCGTTGCGGCGATTTGGTTCACTCTCACCGCCGGAATCTTGATCGAGTGGAATCGCTTTTTCCCTGATCTCCTCTTCCACCCCATGGGCTGA
Sequence MKKFLTTAPVVAAIWFTLTAGILIEWNRFFPDLLFHPMG
Source of smORF Swiss-Prot
Function May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}.
Pubmed ID 16938853
Domain CDD:420030
Functional Category Others
Uniprot ID Q0I867
ORF Length (Amino Acid) 39
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 24
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3164187 3164303 - NC_019675.1 Cyanobium gracile PCC 6307
2 5019933 5020055 - NZ_CP021983.2 Halomicronema hongdechloris C2206
3 679715 679834 + NC_019771.1 Anabaena cylindrica PCC 7122
4 5099537 5099656 + NC_014248.1 'Nostoc azollae' 0708
5 4875738 4875857 + NC_010628.1 Nostoc punctiforme PCC 73102
6 2975515 2975634 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
7 2524509 2524634 + NC_004113.1 Thermosynechococcus vestitus BP-1
8 750425 750550 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
9 1141805 1141933 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
10 5549867 5549986 - NZ_CP031941.1 Nostoc sphaeroides
11 43585 43716 - NZ_CP018092.1 Synechococcus lividus PCC 6715
12 4211954 4212073 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
13 3171915 3172034 + NZ_CP042326.1 Euhalothece natronophila Z-M001
14 4343975 4344103 + NC_010296.1 Microcystis aeruginosa NIES-843
15 446939 447073 - NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
16 1430824 1430937 - NC_009925.1 Acaryochloris marina MBIC11017
17 3563700 3563825 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
18 329772 329879 - NC_019776.1 Cyanobacterium aponinum PCC 10605
19 3504030 3504149 - NC_014501.1 Gloeothece verrucosa PCC 7822
20 2220418 2220546 + NC_019780.1 Dactylococcopsis salina PCC 8305
21 5748913 5749044 + NC_019751.1 Calothrix sp. PCC 6303
22 527530 527649 - NC_019689.1 Pleurocapsa sp. PCC 7327
23 732078 732191 - NC_019748.1 Stanieria cyanosphaera PCC 7437
24 2028341 2028475 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_019675.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00814.27 0.83 20 738.0 opposite-strand tRNA N6-adenosine threonylcarbamoyltransferase
++ More..