| Protein name |
Cytochrome b6-f complex subunit 6 (Cytochrome b6-f complex subunit PetL) (Cytochrome b6-f complex subunit VI) |
| NCBI Accession ID |
CP000435.1 |
| Organism |
Synechococcus sp. (strain CC9311) |
| Left |
2237249 |
| Right |
2237362 |
| Strand |
- |
| Nucleotide Sequence |
TTGCTGCAATCTGTGTCTGTTATGGGCGTCGTTATTTATTTAGGTCTTGTGGGTGCCGGTTTGGTTGCAGCTTTTGCCTTCAGCACTCTTCTGCGCAGTATCAAGCTGATTTGA |
| Sequence |
MLQSVSVMGVVIYLGLVGAGLVAAFAFSTLLRSIKLI |
| Source of smORF |
Swiss-Prot |
| Function |
Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetL is important for photoautotrophic growth as well as for electron transfer efficiency and stability of the cytochrome b6-f complex (By similarity). {ECO:0000250}. |
| Pubmed ID |
16938853
|
| Domain |
|
| Functional Category |
Others |
| Uniprot ID |
Q0I733
|
| ORF Length (Amino Acid) |
37 |