Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein ZapA (Z ring-associated protein ZapA) |
NCBI Accession ID | CP000436.1 |
Organism | Haemophilus somnus (strain 129Pt) (Histophilus somni) |
Left | 730010 |
Right | 730309 |
Strand | + |
Nucleotide Sequence | ATGTCAAAGCTCATTGAATTATCCGTATCAGGGCAAGTACTACGTTTAAATTGTCCTCCAGAACAACACGATGCTTTACGTCAAGCGGCACATTTATTAGATAATCGTGTTATGGAAATGAGAGAGCGTACCGGTATTTTACAGATGGAAAAAATCCTCTCTATTGTTGCATTAAATTTAAGTTTTGAACTGATGCAGGAACAACAAAAAACTCAAACAATCGAAAATGTCATTAATCAAAAGATTGCTCAACTCGAAGGATCTTTGGAGAATATTTTGGCTCAAAAAACAACTTTTTAA |
Sequence | MSKLIELSVSGQVLRLNCPPEQHDALRQAAHLLDNRVMEMRERTGILQMEKILSIVALNLSFELMQEQQKTQTIENVINQKIAQLEGSLENILAQKTTF |
Source of smORF | Swiss-Prot |
Function | Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division (By similarity). {ECO:0000250}. |
Pubmed ID | 17172329 |
Domain | CDD:412769 |
Functional Category | Others |
Uniprot ID | Q0I2U9 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1385478 | 1385777 | - | NZ_CP018804.1 | Histophilus somni |
2 | 59834 | 60115 | - | NZ_LR134167.1 | Avibacterium volantium |
3 | 226743 | 227003 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
4 | 151061 | 151366 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
5 | 1109098 | 1109367 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
6 | 46114 | 46389 | - | NZ_CP015031.1 | Basfia succiniciproducens |
7 | 441358 | 441633 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
8 | 683055 | 683357 | - | NZ_CP028926.1 | Pasteurella multocida |
9 | 2171206 | 2171469 | + | NZ_LT906448.1 | Pasteurella dagmatis |
10 | 1036824 | 1037114 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
11 | 242824 | 243072 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
12 | 143308 | 143568 | - | NZ_CP009610.1 | Haemophilus influenzae |
13 | 153392 | 153652 | - | NZ_LS483429.1 | Haemophilus aegyptius |
14 | 117013 | 117261 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
15 | 1215428 | 1215670 | - | NZ_CP040863.1 | Rodentibacter heylii |
16 | 1878570 | 1878860 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
17 | 1149047 | 1149337 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
18 | 334933 | 335217 | + | NZ_CP016604.1 | Otariodibacter oris |
19 | 4511 | 4840 | + | NZ_CP015029.1 | Frederiksenia canicola |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01812.22 | 0.95 | 18 | 290.0 | same-strand | 5-formyltetrahydrofolate cyclo-ligase family |
2 | PF03695.15 | 0.74 | 14 | 136.5 | opposite-strand | Uncharacterised protein family (UPF0149) |