Result : Q0BWC7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0434 protein HNE_3545 |
| NCBI Accession ID | CP000158.1 |
| Organism | Hyphomonas neptunium (strain ATCC 15444) |
| Left | 3682484 |
| Right | 3682741 |
| Strand | - |
| Nucleotide Sequence | ATGAGCGATTTGCCAGACCAGACTCCAAAGGATGACAGCGTCCTGTTCGAGGCCAACGGGGTTGACCCGCGCCTGCTCGAAATCCTGATCTGCCCCGCCACGCGCCAACCGCTGGCCTATGACCGCGCGCGCCATGAACTCGTCTCGAAGAATGCTCGCCTCGCCTATCCCATCCGCGGGGGCATTCCCATCATGCTGGAAGAAGAAGCACGCGACCTTGATGATACGGAAGGCACAGCTGGCGGGGGCGAGGCATGA |
| Sequence | MSDLPDQTPKDDSVLFEANGVDPRLLEILICPATRQPLAYDRARHELVSKNARLAYPIRGGIPIMLEEEARDLDDTEGTAGGGEA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01066. Profile Description: Trm112p-like protein. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C-terminus contains the strongest conservation. Trm112p is required for tRNA methylation in S. cerevisiae and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices. |
| Pubmed ID | 16980487 |
| Domain | CDD:412721 |
| Functional Category | Others |
| Uniprot ID | Q0BWC7 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3457941 | 3458153 | + | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 2 | 2827304 | 2827522 | - | NZ_CP016616.1 | Microvirga ossetica |
| 3 | 258163 | 258375 | - | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 4 | 293407 | 293619 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 5 | 2336239 | 2336448 | + | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
| 6 | 2423705 | 2423917 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 7 | 6905891 | 6906103 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 8 | 3113149 | 3113397 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 9 | 2356966 | 2357178 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 10 | 2513014 | 2513250 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 11 | 819258 | 819482 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 12 | 3002399 | 3002617 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 13 | 3408877 | 3409092 | + | NZ_CP019948.1 | Methylocystis bryophila |
| 14 | 298847 | 299086 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 15 | 2348391 | 2348597 | + | NC_021287.1 | Caballeronia insecticola |
| 16 | 1747569 | 1747775 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 17 | 617420 | 617626 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 18 | 1159548 | 1159766 | + | NZ_CP040818.1 | Paraoceanicella profunda |
| 19 | 1027794 | 1028033 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 20 | 1228157 | 1228363 | + | NZ_CP009727.1 | Burkholderia mallei |
| 21 | 829988 | 830194 | + | NZ_CP008781.1 | Burkholderia pseudomallei |
| 22 | 3519719 | 3519970 | - | NZ_CP036532.1 | Roseitalea porphyridii |
| 23 | 26464 | 26670 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 24 | 3371138 | 3371344 | + | NZ_CP010650.1 | Phaeobacter inhibens |
++ More..