Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division topological specificity factor |
NCBI Accession ID | CP000437.1 |
Organism | Francisella tularensis subsp. holarctica (strain OSU18) |
Left | 503201 |
Right | 503473 |
Strand | - |
Nucleotide Sequence | ATGCTAGCTAAACTTTTTGGATTAAGTAAAAAACAACAGAGTGCTTCAGTAGCTAAAGAAAGGCTACAGATCATTGTTGCTCATCAAAGAAGTGAGTTACATCCAAGATCTTCTAAGATAAGTAGCCACTTACTTGCGGAACTCAAAGATGAAATAATTGAAGTTGTCAAAAAATATGTTGCTTTGTCTGAAGAGAATATTAGAGATATTGATCTAAAAGTTGAAGATAGTAGCAAAAATTCAACTATAGAAGTTAATATTCCTTTTAACTAA |
Sequence | MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKNSTIEVNIPFN |
Source of smORF | Swiss-Prot |
Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
Pubmed ID | 16980500 |
Domain | CDD:412433 |
Functional Category | Others |
Uniprot ID | Q0BN41 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 299873 | 300145 | - | NC_017449.1 | Francisella hispaniensis |
2 | 1489692 | 1489964 | + | NZ_CP022375.1 | Francisella opportunistica |
3 | 1131803 | 1132075 | + | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
4 | 346716 | 346988 | - | NC_015696.1 | Francisella salina |
5 | 1452349 | 1452621 | + | NZ_CP043552.1 | Francisella marina |
6 | 371827 | 372099 | - | NZ_CP022132.1 | Francisella halioticida |
7 | 369420 | 369692 | - | NZ_CP016796.1 | Francisella uliginis |
8 | 1714741 | 1715013 | + | NZ_CP021781.1 | Francisella adeliensis |
9 | 122173 | 122445 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
10 | 216881 | 217153 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
11 | 217618 | 217890 | - | NZ_CP038241.1 | Allofrancisella inopinata |
12 | 103106 | 103390 | + | NZ_CP009654.1 | Francisella frigiditurris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13466.8 | 0.75 | 9 | 2849 | same-strand | STAS domain |
2 | PF05494.14 | 0.75 | 9 | 2188 | same-strand | MlaC protein |
3 | PF02470.22 | 1.0 | 12 | 1581.5 | same-strand | MlaD protein |
4 | PF02405.18 | 1.0 | 12 | 817.5 | same-strand | Permease MlaE |
5 | PF00005.29 | 1.0 | 12 | 15.0 | same-strand | ABC transporter |
6 | PF13614.8 | 1.0 | 12 | 3.0 | same-strand | AAA domain |
7 | PF01656.25 | 1.0 | 12 | 3.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
8 | PF10609.11 | 1.0 | 12 | 3.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
9 | PF03775.18 | 1.0 | 12 | 858.0 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
10 | PF05209.15 | 1.0 | 12 | 858.0 | same-strand | Septum formation inhibitor MinC, N-terminal domain |
11 | PF00471.22 | 1.0 | 12 | 1576.0 | same-strand | Ribosomal protein L33 |
12 | PF00830.21 | 1.0 | 12 | 1760.0 | same-strand | Ribosomal L28 family |
13 | PF13627.8 | 0.83 | 10 | 2138.5 | same-strand | Prokaryotic lipoprotein-attachment site |